@ 3c7dc2c5:805642a8

🧠Quote(s) of the week:

'Bitcoin is a high-IQ, low-time-preference asset in a world addicted to DoorDash, dopamine, and debt. Holding Bitcoin requires patience, conviction, and the ability to not panic when CNBC tells you it’s dead for the 47th time. That rules out, oh, I don’t know - 95% of the population? This isn’t some egalitarian revolution. This is a cognitive filter disguised as a monetary network. The rich, the strategic, the elite - those who understand volatility as an opportunity - will stack the hardest asset on Earth while the masses beg for interest rate cuts and $600 stimmies to buy groceries they can't afford.

It's not a level playing field. It's a time-preference war, and Bitcoin is the scoreboard. And every cycle, we watch it happen again. The media ridicules it, the politicians fear it, and the smart money buys more. While fiat punishes savers and rewards financial nihilism, Bitcoin inverts the whole structure. It’s a vault for those who can delay gratification, think generationally, and understand that true wealth is preserved rather than printed. The game isn’t rigged. It’s just calibrated for adults.' - Adam Livingston

'Bitcoin is an extremely simple thesis. If you think governments will stop debasing and debanking: number go down. If you think they won’t stop debasing and debanking: number go up'- Alex Gladstein

Something to ponder on.

🧡Bitcoin news🧡

On the 28th of April:

➡️Hunter Horsley: 'Bitcoin at $94k, yet — Google searches for "Bitcoin" near long-term lows. This hasn't been retail-driven. Institutions, advisors, corporations, and nations have come into the space. The types of investors buying Bitcoin are expanding.'

➡️Daniel Batten: 'Cambridge has just released their updated report on Bitcoin mining. For the first time, their report shows that most (52.4%) of the Bitcoin network is now powered by zero-emission energy sources (up from 37% in their last report).

Here's a summary of their findings:

https://x.com/DSBatten/status/1916903476610650202

You can read the full report here

➡️Arizona’s Bitcoin Reserve bill (SB 1025) just passed the House and now heads to the desk of Governor Katie Hobbs. However, Governor Hobbs has vowed to veto any legislation until a budget impasse over funding for disability services is resolved.

On the 29th of April:

➡️Bitcoin Archive: 'South Korea's ruling party to approve spot Bitcoin ETFs, scrap restrictive banking crypto rules, and introduce crypto-friendly framework THIS YEAR, if it wins the June election.'

➡️President Trump's Executive Director says there is a "space race" amongst countries to accumulate Bitcoin: "We view Bitcoin as digital gold."

➡️U.S. to "turbo-charge" Bitcoin mining growth by allowing Bitcoin miners to build power plants and data centres near natural gas fields - Howard Lutnick, Commerce Secretary

➡️Japanese clothing company ANAP Holdings Inc. bought 35 Bitcoins worth $3.3 million. ANAP now holds 51.7 BTC, joining Japan’s growing corporate Bitcoin treasury movement.

➡️Semler Scientific adds 165 BTC for $15.7M, bringing total holdings to 3,467 BTC. The company reports a 23.8% BTC yield year-to-date.

➡️The Bitcoin hashrate has already surged over 17% since the start of the year.

➡️'This shattered a major myth for me: gold production isn’t slowing down—it’s accelerating. According to NYDIG, annual gold mining has been steadily increasing over time, about 1.6% per year, thanks to better extraction technology. In fact, 2024 saw a 1% year-over-year increase, setting an all-time high in gold output (World Gold Council). So why do so many still believe the outdated narrative that gold is becoming harder to find? The truth is: gold is effectively unlimited in supply—we just get better at digging it up. If that surprises you, you're probably not nearly bullish enough on Bitcoin.' - Robert Hefner https://i.ibb.co/JWCHndQk/Gpu-W9-R1-Xw-AAiy-Cv.jpg

On the 30th of April:

➡️The Bank of Italy identifies Bitcoin as an emerging risk factor with concerns for the financial system.

"The strong growth of Bitcoin and other crypto-assets with high price volatility means risks not only for investors but also potentially for financial stability, given the growing interconnections between the digital asset ecosystem, the traditional financial sector, and the real economy,”

Tell me you are scared of Bitcoin without telling me you are scared of Bitcoin.

➡️4 major wirehouses managing $10 TRILLION to start offering Bitcoin ETFs to clients this year, says BitWise CIO Matt Hougan. Merrill Lynch, Morgan Stanley, Wells Fargo, and UBS are coming to the party.

➡️Roswell, New Mexico, becomes the 1st United States city to launch a strategic Bitcoin reserve.

➡️BlackRock’s Bitcoin ETF IBIT has hit 600,000 BTC!

➡️Semler Scientific bought 165 Bitcoins worth $15.7m. They now hold 3,467 BTC on their balance sheet.

➡️Bitcoin News: 'El Salvador is still buying Bitcoin despite an IMF loan deal that required it to stop. Economy Minister Maria Luisa Hayem confirmed ongoing accumulation, calling Bitcoin “an important project” and a key asset for both the government and private sector.'

➡️New whales are buying Bitcoin faster than ever before!

➡️'ZachXBT says the $330M Bitcoin theft involved an elderly U.S. victim targeted by social engineering. The stolen 3,520 BTC were laundered through six exchanges and swapped into Monero, triggering a 50% price spike due to thin liquidity.' -Bitcoin News

On the 1st of May:

➡️North Carolina Bitcoin Reserve Bill has passed the House! This bill enables state retirement funds to invest up to $ 13 B.

➡️Tether’s latest attestation states the company holds $7.6 billion in Bitcoin.

➡️Europe's largest Bitcoin treasury company, The Blockchain Group, aspires to hold 1% of the total Bitcoin supply by 2033.

➡️FiatHawk: 'Central banks create fake money to buy real gold, and we’re supposed to pretend this isn’t theft. The game is rigged. Their paper is trash. Gold knows it. Bitcoin ends it. Stop believing the lie.

https://i.ibb.co/mrBZtY5P/Gpl4kl-ak-AA-xv-D.png

When the debt bubble collapses, only sound money with zero counterparty risk matters. Currently, sound money is less than 5% of debt money, and Bitcoin is so tiny it is barely visible on the chart. Stay humble and keep stacking.' https://i.ibb.co/QF0Vf9k8/Gpu-CCIWa-YAAng1-U.png

On the 2nd of May:

➡️ Regarding the whole OP_Return debate.

Grok: ++Key Points: ++ * The OP_RETURN debate in Bitcoin centers on whether its blockchain should store data beyond financial transactions, with ongoing controversy. * It began in 2010 with concerns about blockchain bloat, intensified in 2014 with the "OP_Return Wars," and continues today. * Research suggests the debate reflects a balance between Bitcoin's monetary purpose and potential for broader applications like Dapps. * Compromises, like setting a 40-byte limit in 2014, aimed to address concerns but didn't fully resolve tensions, influencing platforms like Ethereum.

++Background++ OP_RETURN is a Bitcoin script opcode allowing small data storage in transactions, useful for timestamping or Dapps, but raising concerns about blockchain bloat.

++Historical Context++

The debate started in 2010 with the BitDNS proposal, where Satoshi Nakamoto worried about scalability, leading to Namecoin. It peaked in 2014 with Counterparty's use, leading to a 40-byte limit compromise, later adjusted to 83 bytes by 2016.

++Recent Developments++ By 2018-2019, high OP_RETURN usage (20% of transactions) sparked fee debates, but usage has since declined, though data remains, with recent 2023 controversies over size limits.

If you are interested in Bitcoin, then you should check out the following video.

Great video from @GrassFedBitcoin explaining the current OP_RETURN situation. The choice isn’t between bloating the UTXO set or increasing OP_RETURN, it’s whether we normalize spam or we reject it. Is Bitcoin for data storage or financial transactions? https://www.youtube.com/watch?v=15biQH1H140 Every Bitcoiner needs to see this! Vires in Numeris.

A great counterargument by Seth for Privacy:

https://x.com/sethforprivacy/status/1919003009880616976

Personally, I tend to agree with Seth.

To sum it up:

If you are running a node, you should switch from Core to Knots immediately. It's very straightforward, and you don't need to redo the initial block download.

If you arent running a node you are a leech and need to get your shit together.

➡️Tether CEO defends skipping MiCA, calling EU stablecoin rules “very dangerous.” Ardoino: “The European Central Bank is more interested in pushing the digital euro to control people and how they spend their money.”

On the 3rd of May:

➡️Arizona Governor Katie Hobbs has vetoed the state’s Strategic Bitcoin Reserve legislation after it was passed by the House and Senate. She states: “Arizonans’ retirement funds are not the place for the state to try untested investments like virtual currency.”

Apparently, the Arizona State Retirement System already holds 53,097 shares of MSTR. You can’t make this shit up.

➡️Vitalik Buterin: 'One of the best things about Bitcoin is how simple it is. This simplicity has lots of benefits. Let's bring those benefits to Ethereum.' Almost like Bitcoin is eh......(checks notes)......better tech. Just use Bitcoin, dumbfuck! 'It's only taken a decade, but Ethereum's creator is having an inkling that he never should have created Ethereum, which destroyed billions of precious capital and instead focused on Bitcoin.' - Vijay Boyapati

There is no second best!

On the 4th of May:

➡️Eli Nagar:

Heads up, Bitcoin holders: The EU will ban anonymous crypto accounts by July 2027. Every transaction above €1,000 will need your ID. Privacy is becoming extinct. Every new restriction is a marketing campaign for Bitcoin. “Hi, we’re the EU. We’ll surveil you, control your money, and criminalise privacy.” By doing that, they have decided to help promote the black market...great work, EU! Oh, and remember, the EU can't ban what it has no control over: hold your own private keys.

➡️Cumulative inflows into the Bitcoin ETFs have hit a fresh ATH of $ 40.62 B.

On the 5th of May:

➡️Brown University invested $4.9M in Bitcoin via BlackRock's IBIT, as disclosed in a recent SEC filing. The university owns 105K IBIT shares ($5.8M), 2.3% of Brown's reported $216M equity holdings.

➡️Strategy acquires 1,895 BTC for $180.3 million at an average price of $95,167 per bitcoin. As of May 4, 2025, they hold 555,450 BTC acquired for $38.08 billion at an average price of $68,550 per bitcoin.

💸Traditional Finance / Macro:

On the 3rd of May:

👉🏽Berkshire Hathaway cash pile hits record $347.7bn in 1Q as Warren Buffett sells stocks for 10th quarter in a row. Buffett is still raising cash. https://i.ibb.co/1GK6Dvzx/Gq-Bp6q-BW4-AAKKlm.jpg

🏦Banks:

👉🏽 No news

🌎Macro/Geopolitics:

On the 27th of April:

👉🏽World central banks are diversifying their reserves: Foreign holdings of Treasuries as % of US government debt have fallen to ~23%, the lowest in 22 years. The percentage is down ~11 percentage points over the last 9 years. At the same time, gold holdings as a % of global international reserves have hit ~18%, the highest in 26 years. The share has risen by ~8 percentage points since 2015. China has been one of the biggest buyers of gold over the last few years. Since the beginning of 2023, China’s gold reserves as a % of total foreign reserves have doubled to 7.1%.

Everyone wants gold. https://i.ibb.co/NgX11DZh/Gp4-GKc-HWMAAa-FYu.jpg

On the 28th of April:

👉🏽TKL: 'Tariffs are hitting American meat exports.

China's cancellations of US pork shipments are skyrocketing: China cancelled shipments of ~12,000 metric tons of US pork last week, the most since the 2020 pandemic, when global supply chains were halted. As a result, overall US pork export sales dropped to their lowest level since October, according to Bloomberg. This comes as American pork imports to China now face a massive 172% tariff. This includes the duties first imposed during the 2018 trade war.'

On the 29th of April:

👉🏽The U.S. Treasury will now need to borrow $514 billion this quarter, an increase of 320% from its previous estimate.

On the 30th of April:

👉🏽'Bad news for electricity consumers: despite 84 hours of negative pricing (2024: 62 hours), the average electricity price in the Netherlands in April was €75/MWh — nearly 30% higher than a year ago.' - Martien Visser

https://i.ibb.co/VsrFdKy/Gps0l-Au-Xs-AA20-OA.png

👉🏽Tax cuts for the rich lead to higher income inequality. However, they do not have any significant effect on economic growth or unemployment. Empirical evidence for advanced economies over 1965-2015:

https://academic.oup.com/ser/article/20/2/539/6500315?login=false

Trickle down never worked.

👉🏽"Since February 2020, home prices have increased 45%," according to Zillow So has the broad money supply. Not your house is getting more expensive; The money is getting devalued.

Money supply= +40%

Median home= +40%

Experts: "What could have ever caused this????"

And some freaking guru on Instagram or Tiktok is trying to convince you to get his/her 'buying/renting a house' course. https://i.ibb.co/bMXfW3vp/Gp0-CXg-Ka-YAAIhq-J.jpg

👉🏽SUMMARY OF US Q1 GDP REPORT: 1. The U.S. economy contracted at an annual rate of -0.3% in the first quarter, compared to expectations for an increase of 0.2%. That’s down from the growth of 2.4% in Q4. 2. Real consumer spending rose by 1.8% Y/Y, after increasing 4.0% in Q4. 3. The GDP Price Index rose 3.7%, above estimates of 3.1%. 4. Core PCE Prices rose 3.5%, after increasing 2.6% in Q4.

• Key Takeaway: Fears of stagflation are growing as the economy grinds to a halt and inflation ticks higher. - Jesse Cohen

👉🏽World debt has now officially crossed $300 TRILLION, and still continues to climb aggressively. This will not end well…

https://i.ibb.co/Kxm2bJs6/Gpyi-Ouwa-YAEDg-Pq.jpg

👉🏽'March PCE inflation, the Fed's preferred inflation measure, FALLS to 2.3%, above expectations of 2.2%. Core PCE inflation FALLS to 2.6%, in line with expectations of 2.6%. February Core PCE inflation was revised up to 3.0%. All eyes are on the Fed next week.' - TKL

🎁If you have made it this far, I would like to give you a little gift, well, in this case, two gifts:

Smitty's Bitcoin Retirement Guide:

"Helping you develop a better Bitcoin stacking target for life planning." - Sminston With This is a fantastic tool. Very, very useful. I will keep mentioning it. Bitcoin is a savings vehicle. Period!

https://x.com/sminston_with/status/1917605539279954391

The best kind of retirement starts in diapers and ends in diapers, so start now. https://i.ibb.co/4RwFxR0W/Gpys-GQga-YAIxm-MX.jpg

nofinancialadvice

Credit: I have used multiple sources!

My savings account: Bitcoin The tool I recommend for setting up a Bitcoin savings plan: PocketBitcoin especially suited for beginners or people who want to invest in Bitcoin with an automated investment plan once a week or monthly.

Use the code SE3997

Get your Bitcoin out of exchanges. Save them on a hardware wallet, run your own node...be your own bank. Not your keys, not your coins. It's that simple. ⠀ ⠀

⠀⠀ ⠀ ⠀⠀⠀

Do you think this post is helpful to you?

If so, please share it and support my work with a zap.

▃▃▃▃▃▃▃▃▃▃▃▃▃▃▃▃▃▃

⭐ Many thanks⭐

Felipe - Bitcoin Friday!

▃▃▃▃▃▃▃▃▃▃▃▃▃▃▃▃▃▃

@ c9badfea:610f861a

1. Install Squircle (it's free and open source)
2. Launch the app, tap the ⁞ icon and select Settings
   • Configure your Git credentials as needed
   • Add any remote servers under Cloud & Servers
3. Return to the editor view and enjoy your mobile IDE

ℹ️ To clone a Git repository, tap ☰, long-press a directory in the file tree, and choose Clone

ℹ️ You may want to use it alongside Termux, a terminal emulator and Linux environment

@ 7459d333:f207289b

Come to our meetup to discuss the great Bitcoin Core debate!

The proposal to remove the 80-byte limit on OP_RETURN is getting people talking: should Bitcoin prioritize only monetary transactions or allow more data, such as notarizations?

Some argue that this simplifies the protocol and reflects what already happens in practice, with data stuffed in less efficient ways (as in Taproot).

Others fear it will overload the blockchain and take Bitcoin away from its essence....

Bring your opinion, enjoy a beer and let's debate the future of Bitcoin!

https://t.me/madridmeetup

originally posted at https://stacker.news/items/976659

@ d61f3bc5:0da6ef4a

I remember the first gathering of Nostr devs two years ago in Costa Rica. We were all psyched because Nostr appeared to solve the problem of self-sovereign online identity and decentralized publishing. The protocol seemed well-suited for textual content, but it wasn't really designed to handle binary files, like images or video.

The Problem

When I publish a note that contains an image link, the note itself is resilient thanks to Nostr, but if the hosting service disappears or takes my image down, my note will be broken forever. We need a way to publish binary data without relying on a single hosting provider.

We were discussing how there really was no reliable solution to this problem even outside of Nostr. Peer-to-peer attempts like IPFS simply didn't work; they were hopelessly slow and unreliable in practice. Torrents worked for popular files like movies, but couldn't be relied on for general file hosting.

Awesome Blossom

A year later, I attended the Sovereign Engineering demo day in Madeira, organized by Pablo and Gigi. Many projects were presented over a three hour demo session that day, but one really stood out for me.

Introduced by hzrd149 and Stu Bowman, Blossom blew my mind because it showed how we can solve complex problems easily by simply relying on the fact that Nostr exists. Having an open user directory, with the corresponding social graph and web of trust is an incredible building block.

Since we can easily look up any user on Nostr and read their profile metadata, we can just get them to simply tell us where their files are stored. This, combined with hash-based addressing (borrowed from IPFS), is all we need to solve our problem.

How Blossom Works

The Blossom protocol (Blobs Stored Simply on Mediaservers) is formally defined in a series of BUDs (Blossom Upgrade Documents). Yes, Blossom is the most well-branded protocol in the history of protocols. Feel free to refer to the spec for details, but I will provide a high level explanation here.

The main idea behind Blossom can be summarized in three points:

1. Users specify which media server(s) they use via their public Blossom settings published on Nostr;
2. All files are uniquely addressable via hashes;
3. If an app fails to load a file from the original URL, it simply goes to get it from the server(s) specified in the user's Blossom settings.

Just like Nostr itself, the Blossom protocol is dead-simple and it works!

Let's use this image as an example:

If you look at the URL for this image, you will notice that it looks like this:

blossom.primal.net/c1aa63f983a44185d039092912bfb7f33adcf63ed3cae371ebe6905da5f688d0.jpg

All Blossom URLs follow this format:

[server]/[file-hash].[extension]

The file hash is important because it uniquely identifies the file in question. Apps can use it to verify that the file they received is exactly the file they requested. It also gives us the ability to reliably get the same file from a different server.

Nostr users declare which media server(s) they use by publishing their Blossom settings. If I store my files on Server A, and they get removed, I can simply upload them to Server B, update my public Blossom settings, and all Blossom-capable apps will be able to find them at the new location. All my existing notes will continue to display media content without any issues.

Blossom Mirroring

Let's face it, re-uploading files to another server after they got removed from the original server is not the best user experience. Most people wouldn't have the backups of all the files, and/or the desire to do this work.

This is where Blossom's mirroring feature comes handy. In addition to the primary media server, a Blossom user can set one one or more mirror servers. Under this setup, every time a file is uploaded to the primary server the Nostr app issues a mirror request to the primary server, directing it to copy the file to all the specified mirrors. This way there is always a copy of all content on multiple servers and in case the primary becomes unavailable, Blossom-capable apps will automatically start loading from the mirror.

Mirrors are really easy to setup (you can do it in two clicks in Primal) and this arrangement ensures robust media handling without any central points of failure. Note that you can use professional media hosting services side by side with self-hosted backup servers that anyone can run at home.

Using Blossom Within Primal

Blossom is natively integrated into the entire Primal stack and enabled by default. If you are using Primal 2.2 or later, you don't need to do anything to enable Blossom, all your media uploads are blossoming already.

To enhance user privacy, all Primal apps use the "/media" endpoint per BUD-05, which strips all metadata from uploaded files before they are saved and optionally mirrored to other Blossom servers, per user settings. You can use any Blossom server as your primary media server in Primal, as well as setup any number of mirrors:

## Conclusion

For such a simple protocol, Blossom gives us three major benefits:

1. Verifiable authenticity. All Nostr notes are always signed by the note author. With Blossom, the signed note includes a unique hash for each referenced media file, making it impossible to falsify.
2. File hosting redundancy. Having multiple live copies of referenced media files (via Blossom mirroring) greatly increases the resiliency of media content published on Nostr.
3. Censorship resistance. Blossom enables us to seamlessly switch media hosting providers in case of censorship.

Thanks for reading; and enjoy! 🌸

@ 6830c409:ff17c655

Disclaimer: I used Grammarly AI to correct my poor English to look polished. **

Preface: The motivation behind this note stems from a personal curiosity sparked by a few interactions with someone I know. After watching a YouTube video by Salvaveritate on Narcissistic Personality Disorder, I realized that what I was observing wasn’t purely NPD-it seemed to be intertwined with something else. I wanted to better understand this person’s thought process and what might be driving their behavior. At the end of this note, I’ve included the references I consulted to explore this phenomenon further.

We’ve all encountered that person who walks into a room like they own it-dismissing every idea but their own and expecting the world to revolve around them. There’s confidence, and then there’s a level of self-importance so exaggerated it becomes something darker. That, in a nutshell, is megalomania.

Though it’s no longer a formal psychological diagnosis (now categorized under narcissistic personality disorder), the term “megalomania” still resonates when we describe someone with delusional beliefs about their power, brilliance, or importance. It’s not just arrogance-it’s a complete departure from reality, where self-worth is inflated to cartoonish proportions.

The Many Faces of Megalomania

Megalomaniacs aren’t always easy to spot at first. They can be charismatic, persuasive, and even inspiring-until you begin to notice the patterns. Here are some of the archetypes you might recognize:

• The Political Power Player: From infamous historical figures to the neighborhood HOA president who rules like a tyrant, these individuals believe only they can save the day.

• The Corporate Climber: Ambition isn’t the issue here-it’s the willingness to trample anyone in their path. These folks take credit for others' work and treat colleagues like pawns.

• The Self-Proclaimed Guru: Think of that person who reads one book and suddenly thinks they’ve unlocked the secrets of the universe. They believe they alone hold the truth and must share it with the “less enlightened.”

• The Everyday Ego: Perhaps the most common. They're the friend who always turns the conversation back to themselves or the family member who demands special treatment at every gathering.

Warning Signs to Watch For

If you suspect someone in your orbit might be leaning into megalomaniac territory, here are some red flags:

• They crave admiration but rarely offer it in return.
• Criticism-even the gentle kind - triggers rage or defensiveness.
• They exaggerate achievements or name-drop to elevate their image.
• Rules are for everyone else - they believe they’re exempt.
• People are merely tools to further their personal agenda.

Often, the charm and confidence they exude can blind you to these signs until you're in too deep. Many learn this lesson through tough workplace dynamics, toxic relationships, or manipulative friendships.

How to Protect Yourself

If you're dealing with a megalomaniac, remember: you’re not powerless. Strategies that actually help include:

• Don't feed the ego - Respectful neutrality works better than flattery.
• Set firm boundaries - Be clear about what is and isn’t acceptable.
• Keep records - Especially in professional settings, documentation is crucial.
• Know when to walk away - Some relationships or environments can’t be fixed.
• Seek support - Therapy can equip you with the tools to cope and recover.

Trying to “change” a megalomaniac rarely works-focus instead on preserving your own mental health and emotional well-being.

A Look Through History-and the Mirror

From Hitler and Stalin’s destructive delusions of grandeur to modern business figures like Elizabeth Holmes, history is packed with cautionary tales of unchecked ego. Even pop culture gives us glimpses: Tony Montana in Scarface, Miranda Priestly in The Devil Wears Prada. These characters aren’t just dramatic-they’re psychological case studies in what happens when ego eclipses empathy.

But let’s be honest-none of us are immune to moments of inflated self-worth. The difference lies in self-awareness. True confidence coexists with humility. It laughs at karaoke fails and learns from criticism. Megalomania, by contrast, builds walls around insecurity and calls it a fortress.

Have you ever dealt with someone whose ego became their identity? Or maybe caught yourself slipping into that territory? Let’s unpack it together-your insights could help someone else recognize the signs early.

Here is what I read: 1. https://ebeni.wordpress.com/unethical-leaders/megalomania-and-narcissism-grandiose-vulnerable-clarke/ 2. https://keghart.org/demirdjian-megalomaniac-dictator/ 3. https://fastercapital.com/content/Megalomania--The-Ultimate-Form-of-Hubris.html 4. https://taylorandfrancis.com/knowledge/Medicine_and_healthcare/Psychiatry/Megalomania/ 5. https://www.encyclopedia.com/medicine/psychology/psychology-and-psychiatry/grandiosity 6. Salva Veritate's video: https://www.youtube.com/watch?v=RtUFB3tf1lA&pp=ygUOc2FsdmEgdmVyaXRhdGU%3D

@ c066aac5:6a41a034

This is an article I wrote which originally appeared in the Pamphleteer, a publication run by a friend in Nashville. It has been edited from the published version, which I will link here for everyone to go check out the website and subscribe.

Step back fifty years in time with me if you will. A simpler time. You wake up in the house you could afford on a single income. Instead of blinding yourself with the light of your cell phone first thing in the morning, you wake up to make breakfast and coffee, your mind unencumbered by the stimulus of a thousand notifications. You can’t doom scroll (nor can you conceptualize what that even means).

You breathe in the moment, smelling your coffee with a deliberate, meditative inhale… As this brief moment of Nirvana passes, you decide to pick up the newspaper. You turn to page nine and see that Andy Kaufman, a comedian/performance artist you’ve seen on Taxi and Saturday Night Live, has declared himself “The Inter-Gender Wrestling Champion of the World.”

You are tempted to think this may be a joke, but suddenly you remember that you stepped back in time from the 21st century. You’re a modern person with evolved values. You ask yourself: is this an elaborate bit from Andy Kaufman, or was he simply ahead of his time? After all, you’re from the modern world where Imane Khelif is celebrated for his stunning and brave foray into women’s boxing (and where strangely, most news sources seem to deny that he’s a man).

All of a sudden, you abandon the bigotry of the past and invite Kaufman to come back with you to our present-day society. As you return to social media, endless notifications, a world full of stimulus, you ponder if Andy’s wrestling foray will be accepted for the beautiful thing that it is, rather than taken, without scrutiny, as a joke.

Exiting my narrative device now to speak to you directly: in the not-too-distant past, Andy Kaufman stepped into the ring and goaded women to wrestle with him. Back then, it was a bit. If such an act were to be replicated today, it would likely be celebrated and defended.

Inter-Gender sports pioneering aside, Kaufman's antics made Tennessee history; wrestling legend Jerry Lawler of Memphis went into the ring with Kaufman to relieve a female contestant and treated him to a Tennessee takedown.

Jerry invited the comedian to bring his act to Memphis. Leading up to the match, Kaufman relentlessly mocked his Southern audience, with jokes flexing his intelligence as "someone from Hollywood" and teaching Tennesseans how to use soap. After challenging a few women to wrestle, he was met with a famous Jerry Lawler Pilediver. This led to a staged feud between the two of them. The pair even reached the Letterman Show, with Kaufman in a neck brace.

As far as I know, Kaufman never identified as a woman. I don’t think he (or others from this period) could have fathomed the trans-sports drama occurring now. That said, there is something to be learned from his elaborate inter-gender wrestling bit: we’re watching the absurd unfold on the public stage. We should refuse to be gaslit and adopt Andy’s terminology and call this what it is: inter-gender sports. Whenever a biological man competes against a woman in any sporting event, we should all insist on letting everyone know that it is officially an inter-gender competition.

Maybe this modern dilemma could be solved if everyone surrounding these events treated the whole thing for what it was: an elaborate joke. Imagine if we treated it like WWE. The whole audience already knows it’s rigged anyway. Such rules of engagement would leave true biological women’s sports alone; it would keep their pride intact and be an assurance of physical protection.

That's the end of my original article. Just for fun, I wanted to add a response comment from my sister-in-law. She read the article and shared her thoughts with me, so I figured why not include them here.

I honestly believe mixed sports should be something that is encouraged more in our society—not because we should ignore biological differences and risks, especially in high-impact sports, but because normalizing this collaboration despite our different skill sets can strengthen women’s inclusivity not only as athletes, but in society as a whole. When I played mixed doubles in tennis and joined coed volleyball teams, I was pushed to improve and often held my own, even when the guys hit harder. And there are many sports like shooting, equestrian, archery, ect... that have nothing to do with “physical strength”. Training alongside men, whether in tennis, boxing, or volleyball, never has diminished my ability—it sharpened it, and that kind of mutual growth reflects a deeper value of inclusivity and respect that extends far beyond the sport. Thats my take! :)

@ c9badfea:610f861a

1. Install Grayjay (it's free and open source)
2. Launch the app and navigate to the Sources tab
3. Enable the desired sources (and log in if needed by tapping on the source and scrolling down to Authentication)
4. Go to Android Settings > Apps, select Grayjay, and tap Open By Default and Add Link to automatically open supported links with Grayjay
5. Enjoy

ℹ️ If you are using Obtainium to install apps, search for Grayjay on Complex Apps

@ 30611079:ecac89f8

Um Shell Script simples para facilitar backups bip39 baseados nos números das palavras, coloque o script na mesma pasta que o arquivo contendo as palavras, passe o idioma no 1º argumento (Ex. english) e as palavras em sequência, a saída serão os números correspondentes as palavras passadas no idioma selecionado

```

!/bin/bash

Enter in correct diretory

if [ ${0%/} == $0 ]; then cd ${PWD} elif [ -e ${PWD}/${0%/} ]; then cd ${PWD}/${0%/} else cd ${0%/} fi

file="$1.txt"

index=0 numbers=() for word in "$@"; do while IFS= read -r linha; do if [[ "$linha" == "$word" ]]; then numbers+=($index) break fi ((index++)) done < "$file" index=0 done echo "${numbers[@]}" ```

Fiz para aprender um pouco de Shell Script, podem dizer se está bom e se dá para melhorar algo?

Também fiz outro que faz o processo reverso

@ 52b4a076:e7fad8bd

Introduction

Me and Fishcake have been working on infrastructure for Noswhere and Nostr.build. Part of this involves processing a large amount of Nostr events for features such as search, analytics, and feeds.

I have been recently developing nosdex v3, a newer version of the Noswhere scraper that is designed for maximum performance and fault tolerance using FoundationDB (FDB).

Fishcake has been working on a processing system for Nostr events to use with NB, based off of Cloudflare (CF) Pipelines, which is a relatively new beta product. This evening, we put it all to the test.

First preparations

We set up a new CF Pipelines endpoint, and I implemented a basic importer that took data from the nosdex database. This was quite slow, as it did HTTP requests synchronously, but worked as a good smoke test.

Asynchronous indexing

I implemented a high-contention queue system designed for highly parallel indexing operations, built using FDB, that supports: - Fully customizable batch sizes - Per-index queues - Hundreds of parallel consumers - Automatic retry logic using lease expiration

When the scraper first gets an event, it will process it and eventually write it to the blob store and FDB. Each new event is appended to the event log.

On the indexing side, a Queuer will read the event log, and batch events (usually 2K-5K events) into one work job. This work job contains: - A range in the log to index - Which target this job is intended for - The size of the job and some other metadata

Each job has an associated leasing state, which is used to handle retries and prioritization, and ensure no duplication of work.

Several Workers monitor the index queue (up to 128) and wait for new jobs that are available to lease.

Once a suitable job is found, the worker acquires a lease on the job and reads the relevant events from FDB and the blob store.

Depending on the indexing type, the job will be processed in one of a number of ways, and then marked as completed or returned for retries.

In this case, the event is also forwarded to CF Pipelines.

Trying it out

The first attempt did not go well. I found a bug in the high-contention indexer that led to frequent transaction conflicts. This was easily solved by correcting an incorrectly set parameter.

We also found there were other issues in the indexer, such as an insufficient amount of threads, and a suspicious decrease in the speed of the Queuer during processing of queued jobs.

Along with fixing these issues, I also implemented other optimizations, such as deprioritizing Worker DB accesses, and increasing the batch size.

To fix the degraded Queuer performance, I ran the backfill job by itself, and then started indexing after it had completed.

Bottlenecks, bottlenecks everywhere

After implementing these fixes, there was an interesting problem: The DB couldn't go over 80K reads per second. I had encountered this limit during load testing for the scraper and other FDB benchmarks.

As I suspected, this was a client thread limitation, as one thread seemed to be using high amounts of CPU. To overcome this, I created a new client instance for each Worker.

After investigating, I discovered that the Go FoundationDB client cached the database connection. This meant all attempts to create separate DB connections ended up being useless.

Using OpenWithConnectionString partially resolved this issue. (This also had benefits for service-discovery based connection configuration.)

To be able to fully support multi-threading, I needed to enabled the FDB multi-client feature. Enabling it also allowed easier upgrades across DB versions, as FDB clients are incompatible across versions:

FDB_NETWORK_OPTION_EXTERNAL_CLIENT_LIBRARY="/lib/libfdb_c.so" FDB_NETWORK_OPTION_CLIENT_THREADS_PER_VERSION="16"

Breaking the 100K/s reads barrier

After implementing support for the multi-threaded client, we were able to get over 100K reads per second.

You may notice after the restart (gap) the performance dropped. This was caused by several bugs: 1. When creating the CF Pipelines endpoint, we did not specify a region. The automatically selected region was far away from the server. 2. The amount of shards were not sufficient, so we increased them. 3. The client overloaded a few HTTP/2 connections with too many requests.

I implemented a feature to assign each Worker its own HTTP client, fixing the 3rd issue. We also moved the entire storage region to West Europe to be closer to the servers.

After these changes, we were able to easily push over 200K reads/s, mostly limited by missing optimizations:

It's shards all the way down

While testing, we also noticed another issue: At certain times, a pipeline would get overloaded, stalling requests for seconds at a time. This prevented all forward progress on the Workers.

We solved this by having multiple pipelines: A primary pipeline meant to be for standard load, with moderate batching duration and less shards, and high-throughput pipelines with more shards.

Each Worker is assigned a pipeline on startup, and if one pipeline stalls, other workers can continue making progress and saturate the DB.

The stress test

After making sure everything was ready for the import, we cleared all data, and started the import.

The entire import lasted 20 minutes between 01:44 UTC and 02:04 UTC, reaching a peak of: - 0.25M requests per second - 0.6M keys read per second - 140MB/s reads from DB - 2Gbps of network throughput

FoundationDB ran smoothly during this test, with: - Read times under 2ms - Zero conflicting transactions - No overloaded servers

CF Pipelines held up well, delivering batches to R2 without any issues, while reaching its maximum possible throughput.

Finishing notes

Me and Fishcake have been building infrastructure around scaling Nostr, from media, to relays, to content indexing. We consistently work on improving scalability, resiliency and stability, even outside these posts.

Many things, including what you see here, are already a part of Nostr.build, Noswhere and NFDB, and many other changes are being implemented every day.

If you like what you are seeing, and want to integrate it, get in touch. :)

If you want to support our work, you can zap this post, or register for nostr.land and nostr.build today.

@ 52b4a076:e7fad8bd

I have been recently building NFDB, a new relay DB. This post is meant as a short overview.

Regular relays have challenges

Current relay software have significant challenges, which I have experienced when hosting Nostr.land: - Scalability is only supported by adding full replicas, which does not scale to large relays. - Most relays use slow databases and are not optimized for large scale usage. - Search is near-impossible to implement on standard relays. - Privacy features such as NIP-42 are lacking. - Regular DB maintenance tasks on normal relays require extended downtime. - Fault-tolerance is implemented, if any, using a load balancer, which is limited. - Personalization and advanced filtering is not possible. - Local caching is not supported.

NFDB: A scalable database for large relays

NFDB is a new database meant for medium-large scale relays, built on FoundationDB that provides: - Near-unlimited scalability - Extended fault tolerance - Instant loading - Better search - Better personalization - and more.

Search

NFDB has extended search capabilities including: - Semantic search: Search for meaning, not words. - Interest-based search: Highlight content you care about. - Multi-faceted queries: Easily filter by topic, author group, keywords, and more at the same time. - Wide support for event kinds, including users, articles, etc.

Personalization

NFDB allows significant personalization: - Customized algorithms: Be your own algorithm. - Spam filtering: Filter content to your WoT, and use advanced spam filters. - Topic mutes: Mute topics, not keywords. - Media filtering: With Nostr.build, you will be able to filter NSFW and other content - Low data mode: Block notes that use high amounts of cellular data. - and more

Other

NFDB has support for many other features such as: - NIP-42: Protect your privacy with private drafts and DMs - Microrelays: Easily deploy your own personal microrelay - Containers: Dedicated, fast storage for discoverability events such as relay lists

Calcite: A local microrelay database

Calcite is a lightweight, local version of NFDB that is meant for microrelays and caching, meant for thousands of personal microrelays.

Calcite HA is an additional layer that allows live migration and relay failover in under 30 seconds, providing higher availability compared to current relays with greater simplicity. Calcite HA is enabled in all Calcite deployments.

For zero-downtime, NFDB is recommended.

Noswhere SmartCache

Relays are fixed in one location, but users can be anywhere.

Noswhere SmartCache is a CDN for relays that dynamically caches data on edge servers closest to you, allowing: - Multiple regions around the world - Improved throughput and performance - Faster loading times

routerd

routerd is a custom load-balancer optimized for Nostr relays, integrated with SmartCache.

routerd is specifically integrated with NFDB and Calcite HA to provide fast failover and high performance.

Ending notes

NFDB is planned to be deployed to Nostr.land in the coming weeks.

A lot more is to come. 👀️️️️️️

@ 866e0139:6a9334e5

\ Autor: Kerstin Chavent. Dieser Beitrag wurde mit dem Pareto-Client geschrieben. Sie finden alle Texte der Friedenstaube und weitere Texte zum Thema Frieden hier. Die neuesten Pareto-Artikel finden Sie in unserem Telegram-Kanal.

---

Die neuesten Artikel der Friedenstaube gibt es jetzt auch im eigenen Friedenstaube-Telegram-Kanal.

---

Wir halten uns für erwacht, weil wir das Coronanarrativ durchschaut haben, regierungskritisch unterwegs sind und Russland nicht für den ärgsten Feind der Demokratie halten? Wir informieren uns in alternativen und unabhängigen Medien, folgen geistigen Führern und sehen Spiritualität als einen Teil unseres Daseins auf der Erde? Vielleicht sind wir mit Meditationstechniken vertraut, machen Yoga oder nehmen bewusstseinserweiternde Substanzen zu uns? Wir denken, andere würden noch schlafen, weil sie das nicht tun? Dann haben wir noch einen weiten Weg vor uns.

Aufwachen — wir tun es jeden Morgen und oft auch während der Nacht. Der Kopf ist schwer, vielleicht ein wenig verwirrt, wie in einem Nebel. Die Schleier der Träume hängen noch an uns. Wir sind noch nicht ganz da und brauchen eine Dusche, einen Kaffee oder frische Luft, um langsam durchzukommen und den Tag zu beginnen. In den seltensten Fällen ist es so, dass wir die Augen aufschlagen und hellwach sind, vollkommen präsent und klar. So passt die Metapher auf das, was heute auf den Bewusstseinszustand der Menschen angewendet wird.

Was bedeutet es, wach zu sein? Ein waches Bewusstsein zu haben? Was ist Bewusstsein? Eine der großen Referenzen für Psychologie und Pädagogik hat einen eher beschränkten und materialistisch orientierten Bewusstseinsbegriff. Demnach reiche Bewusstsein nicht über das normale Denken hinaus. Bewusstsein habe ein Mensch immer dann, wenn er in der Lage ist, zu bedenken, ob das, was er tut, vernünftig ist. Das Bewusstsein sei an das Gehirn gebunden. Ein Bewusstsein ohne Aktivität von Nervenzellen im menschlichen Gehirn gebe es nicht. Das sei wissenschaftlicher Konsens. Über noch etwas ist man sich einig:

Nach Jahrhunderten der Bemühung von Neurowissenschaftlern, Psychologen und Philosophen bleibt zu der Frage, wie das Gehirn uns denn Bewusstsein verleiht, wie es Empfindungen, Gefühle und Subjektivität entstehen lässt, nur eine Gewissheit: Wir haben keine Ahnung (1).

Mehr Ahnung haben wir, wenn es darum geht, das menschliche Bewusstsein zu manipulieren. Voraussetzung ist, die zu manipulierende Person in Unkenntnis zu lassen. Es wird ein Gefühl von Machtlosigkeit in ihr erzeugt und ein System von Belohnung und Strafe aufgebaut, um eine autoritäre Machtstruktur, die kein Feedback und keine Änderung ohne Zustimmung oder Anordnung der Führung zulässt, zu installieren. Hierfür ist keine Gewaltanwendung erforderlich. Für eine mentale Umprogrammierung reicht es, jede Form von Kritik zu unterdrücken und Kritiker zu diffamieren, indem man ihnen persönliche Rachemotive oder menschliche Schwäche andichtet (2).

Manipulation mit Angst

Angst ist eines der wirksamsten Mittel, um das Bewusstsein der Menschen zu manipulieren. Wer Angst hat, lässt sich leicht täuschen. Das Bewusstsein verengt sich regelrecht. Damit ergibt sich ein nahezu unerschöpflicher Fundus von Methoden zur Bewusstseinskontrolle. Welche, das erleben wir täglich: die Erschaffung einer Unterhaltungsindustrie und die Verbreitung von Filmen, in denen es vor allem um Mord, Verrat, Krankheit und Betrug geht; Medien, die maximale Verwirrung schaffen; giftige Substanzen in Nahrungsmitteln und Wasser; ein knechtendes Finanzsystem; Medikamente, von denen wir möglichst früh und möglichst lange abhängig sind.

Wer das Bewusstsein der Menschen und damit die Welt in den Griff bekommen will, fängt früh an. Er erfindet zum Beispiel Religionen, die sich nach Möglichkeit gegenseitig bekämpfen.

Er erzählt Geschichten, in denen die eine Hälfte der Menschheit der anderen per se unterlegen sein soll, erfindet Götter, die die einen privilegieren und die anderen bestrafen, und ein Paradies, das irgendwoanders ist als dort, wo wir gerade sind.

Alles ist darauf ausgerichtet, dass der Mensch sich klein, unwürdig, schuldig und vor allem ohnmächtig fühlt. Auf keinen Fall darf er sich seiner angeborenen Möglichkeiten bewusstwerden! Hierfür werden Kinder so früh wie möglich von den Eltern getrennt, bekommen in staatlichen Schulen ihre Kreativität und Eigenmacht aberzogen, werden von technischen Geräten abhängig gemacht und durch Geschlechterverwirrung davon abgehalten, ihre Identität zu entwickeln. So werden sie darauf vorbereitet, zu guten Soldaten des Systems zu werden und in jeden Krieg zu ziehen, der ihnen als notwendig verkauft wird.

Project Blue Beam

Immer mehr Menschen wissen das. Immer mehr erkennen, was auf der Bühne des Welttheaters gespielt wird. Doch sind wir deshalb erwacht? Reicht es, alternative Medien zu konsumieren, bewusstseinserweiternde Substanzen zu sich zu nehmen und regelmäßig zu meditieren, um das eigene Bewusstsein zu entwickeln? Reichen die Bücher, die Workshops und die charismatischen Führer, die überall zu finden sind? Sind wir erwacht, nur weil der Nachbar noch schläft?

Wie würden wir zum Beispiel reagieren, wenn das Projekt „Blue Beam“ durchgespielt werden würde? Natürlich soll es sich hierbei um eine Verschwörungstheorie handeln. Aber nur mal angenommen. Es geht darum, durch das Erschaffen einer allgemeinen Unsicherheit und Hysterie eine neue Weltordnung durchzusetzen.

In einer ersten Etappe sollen künstlich erschaffene Naturkatastrophen dafür sorgen, dass die Menschen sämtliche religiöse Fundamente in Frage stellen. In einer zweiten Etappe werden mittels dreidimensionaler Hologramme verschiedene Gottesbilder in den Himmel projiziert mit dem Ziel, eine Einheitsreligion zu proklamieren. In einer dritten Etappe sollen mittels Niederfrequenzen und per Satellit Gedankengänge gezielt beeinflusst werden, und in einem letzten Schritt soll die Menschheit davon überzeugt werden, dass in allen großen Städten der Welt eine Invasion Außerirdischer nahe bevorsteht.

Jede große Nation soll dazu aufgefordert werden, ihr nukleares Potenzial als Abwehr zu benutzen. Es soll sich jedoch um ein Fake-Manöver handeln. Den Nationen, nun ihrer Waffen entledigt, bliebe nur noch die Hoffnung auf einen göttlichen Eingriff. Alle „erwachten“ Menschen würden von „guten“ außerirdischen Kräften „gerettet“ und entführt werden — womit der neuen Weltordnung auf Erden nichts mehr im Wege stünde. Der Rest der Menschheit würde mittels über elektronische Geräte verbreiteter böser Geister in den Wahnsinn und die totale Hoffnungslosigkeit getrieben werden.

Selbstwirksamkeit?

Die Geschichte ist haarsträubend. Doch wer könnte beschwören, dass sie technisch nicht möglich wäre? Wer könnte sich sicher sein, einer False-Flag-Aktion nicht auf den Leim zu gehen? Wer könnte von sich behaupten, so erwacht, so in seinem Bewusstsein verankert zu sein, dass er sich nicht manipulieren ließe, wenn es darauf ankommt? Wer griffe nicht in der Verzweiflung nach einem Heiligenbild, das am Himmel aufsteigt? Wer wäre erhaben über jede Art von Mind Control?

So möge der stille werden, der sich rühmt, erwacht zu sein. Möge er sich den Schlaf aus den Augen reiben und sich an die Arbeit machen. Denn das Erwachen ist nur der allererste Schritt. Dann geht es erst richtig los.

Dann können wir üben, in die Selbstwirksamkeit zu kommen: das Vertrauen in die eigenen Möglichkeiten, Aufgabenanforderungen wirksam zu bewältigen und auch in Extremsituationen gewünschte Handlungen selbst ausführen zu können.

Die Frage ist nicht, wie erwacht wir uns im Vergleich mit anderen fühlen, sondern welches Selbst- und Menschenbild wir haben und wie wir von unserer natürlichen Schöpferkraft Gebrauch machen. Nicht der ist erwacht, der sich von Katastrophenmeldungen einlullen lässt und sich gemütlich in seinen vier Wänden auf den Weltuntergang vorbereitet, sondern der, der sich darauf besinnt, dass Bewusstsein mehr ist als ein paar Synapsen im Gehirn. Er weiß, dass er über einen freien Willen verfügt, der ihn dazu befähigt, in eine andere Richtung zu gehen.

Außen wie innen

Bewusstsein hängt von keinem spirituellen Führer ab und auch von keinem Gott, der in den Himmel projiziert wird. Bewusstsein ist göttlich. Es ist die Fähigkeit, Dinge wahr-zu-nehmen, ihren Wahrheitsgehalt zu erkennen, die Gabe, aus sich heraus feinfühlig zu sein, hellsichtig, verstehend. Im individuellen Bewusstsein sind das Menschliche und das Göttliche eins. Nichts steht trennend dazwischen. Niemand muss die Erlaubnis für diesen Erkenntnisprozess geben.

Wer bei Bewusstsein ist, den kann man nicht in ein Gedankengefängnis einsperren oder ihn mit Hierarchien beeindrucken. Er weiß, dass das Wesentliche sich im Innen abspielt und dass allein er für das verantwortlich ist, was er erlebt.

Ein hoch entwickeltes Bewusstsein bedeutet, sich von jeder Erwartung zu lösen, dass sich im Außen etwas ändert. Wer sich auf das Außen konzentriert, der hat schon verloren. Er drückt sich selbst den Stempel der Ohnmacht und des Mangels auf oder befeuert die Kriegsmaschinerie, die alles in die Zerstörung treibt.

Im Inneren gilt es, für Harmonie zu sorgen und sich auf die Frequenzen des Schöpferischen einzustellen. So darf sich jeder fragen: Wie sieht es bei mir aus? Bin ich von Menschen umgeben, die mich erniedrigen oder die mich erhöhen? Lebe ich das Leben, das ich mir wünsche? Bin ich im Mangel oder im Überfluss? Bin ich krank oder gesund? Ängstlich oder vertrauend? Zynisch oder liebevoll? Wie halte ich es? Wie ist meine Stimmung? Wie fühle ich mich in dieser Zeit, in dieser Welt? Wage ich es, Nein zu sagen, wenn alle Ja sagen, und Ja, wenn alle Nein sagen?

Wie selbstwirksam bin ich? Wie benutze ich die mir angeborene Schöpferkraft? Lasse ich mit mir machen oder mache ich selbst? Welche Menschen und Ereignisse ziehe ich an? Auf welcher Ebene schwingt meine Energie? Mit welchen Kräften stehe ich in Kontakt? Welche Informationen empfange ich? Wie viel Individualität wage ich? Nicht eine Individualität, die andere ausschließt, sondern eine, die alles miteinschließt und von dem Bewusstsein geleitet wird, dass alles eins ist.

Fühle ich mich getrennt oder verbunden? Fühle ich, dass ich unteilbar bin: in-dividuum? Spüre ich, wie ich aus der Kraft dieser Unteilbarkeit heraus unermessliche Möglichkeiten habe, mein Leben und damit die Welt zu gestalten? Bin ich wirklich erwacht oder halte ich mich nur für etwas Besseres, um bei der nächstbesten Gelegenheit genau das zu tun, was ich an anderen kritisiert habe: mein Heil von außen zu erwarten?

Angst- oder Christusmatrix?

Was auch kommt in der nächsten Zeit: Es wird uns überraschen. Jede Menge Möglichkeiten wird es geben, in denen wir unser Bewusstsein und unsere Individualität auf die Probe stellen können. Auf uns kommt es an! Jeder Mensch, der sich selbst aus der Ohnmacht befreit, befreit auch die Welt ein wenig mehr. Jeder, der sich nicht von schlechten Nachrichten nach unten ziehen lässt, jeder, der darauf achtet, seine Energie möglichst hoch schwingen zu lassen, jeder, der in sich selbst die Lösung sucht, ist ein Segen für diese Zeit, ein Tor für das Göttliche auf Erden.

Göttlich, so die Bewusstseinstrainerin Sandra Weber, ist alles, was natürlich ist, alles, was liebt, was pulsiert, leuchtet und verbunden ist. Wir haben die Wahl, uns per Genmanipulation und künstlicher Intelligenz (KI) immer mehr entmenschlichen zu lassen oder unser multidimensionales Potenzial zu entdecken, unsere Fähigkeit zu Telepathie, Telekinese und Teleportation. Angst- oder Christusmatrix — wofür entscheiden wir uns? Lassen wir durch KI die eigene Lichtkörperaktivierung unterbrechen oder wählen wir die Erhebung und das Vertrauen in unsere Göttlichkeit (3)?

Von hier aus können wir die Bühne überblicken. Wir erkennen: Wir müssen da nicht mitmachen. Wir müssen nicht in das Welttheater einsteigen. Wir müssen nicht die Lichtschwerter auspacken und für das Gute kämpfen. Das Gute kämpft nicht. Das Gute ist. Was wir tun können, ist, uns von den Altlasten zu befreien, die uns unten halten, innere Kämpfe ein für alle Mal zu befrieden und unsere Schatten ins Licht zu bringen.

Erleuchtung ist, wenn die inneren Schatten aufgelöst sind und man alles überblicken kann. Er-innern wir uns. Gehen wir nach innen und bauen wir hier unsere Tempel.

Fassen wir den Mut, wir selbst zu sein. Gehen wir in unsere Herzensmitte, werden wir uns der Bewertungen bewusst, mit der wir unsere Welt in Gut und Böse einteilen, und nehmen wir einen neutralen Standpunkt ein. So kommen wir aus der Dualität zurück in die Polarität, aus einer Welt, in der sich die Dinge gegenseitig vernichten, in eine Welt, in der sie sich ergänzen und kreativ zusammenwirken.

---

Quellen und Anmerkungen:

(1) https://lexikon.stangl.eu/887/bewusstsein\ (2) https://de.wikipedia.org/wiki/Gehirnw%C3%A4sche\ (3) https://www.youtube.com/watch?v=grAFeprqzhs&t=13s

---

Kerstin Chavent ist Sprachlehrerin und lebt in Südfrankreich. Sie schreibt Artikel, Essays und autobiographische Erzählungen. Ihre Schwerpunkte sind der Umgang mit Krisensituationen und Krankheit und die Sensibilisierung für das schöpferische Potential im Menschen. Auf Deutsch erschienen sind Die wilde Göttin, Der Königsweg, Die Enthüllung, In guter Gesellschaft, Die Waffen niederlegen, Das Licht fließt dahin, wo es dunkel ist, Krankheit heilt, Was wachsen will muss Schalen abwerfen, Und Freitags kommt der Austernwagen. Weitere Informationen auf kerstinchavent.de.

---

LASSEN SIE DER FRIEDENSTAUBE FLÜGEL WACHSEN!

Hier können Sie die Friedenstaube abonnieren und bekommen die Artikel zugesandt.

Schon jetzt können Sie uns unterstützen:

• Für 50 CHF/EURO bekommen Sie ein Jahresabo der Friedenstaube.
• Für 120 CHF/EURO bekommen Sie ein Jahresabo und ein T-Shirt/Hoodie mit der Friedenstaube.
• Für 500 CHF/EURO werden Sie Förderer und bekommen ein lebenslanges Abo sowie ein T-Shirt/Hoodie mit der Friedenstaube.
• Ab 1000 CHF werden Sie Genossenschafter der Friedenstaube mit Stimmrecht (und bekommen lebenslanges Abo, T-Shirt/Hoodie).

Für Einzahlungen in CHF (Betreff: Friedenstaube):

Für Einzahlungen in Euro:

Milosz Matuschek

IBAN DE 53710520500000814137

BYLADEM1TST

Sparkasse Traunstein-Trostberg

Betreff: Friedenstaube

Wenn Sie auf anderem Wege beitragen wollen, schreiben Sie die Friedenstaube an: friedenstaube@pareto.space

---

Sie sind noch nicht auf Nostr and wollen die volle Erfahrung machen (liken, kommentieren etc.)? Zappen können Sie den Autor auch ohne Nostr-Profil! Erstellen Sie sich einen Account auf Start. Weitere Onboarding-Leitfäden gibt es im Pareto-Wiki.

@ dc4152b3:dc737a27

181BET là một nền tảng trực tuyến nổi bật, cung cấp cho người dùng những trải nghiệm giải trí đa dạng và đầy sáng tạo. Với một giao diện thân thiện và dễ sử dụng, nền tảng này không chỉ hấp dẫn người tham gia nhờ vào tính năng dễ dàng tiếp cận mà còn bởi chất lượng dịch vụ vượt trội. Bằng cách tối ưu hóa trải nghiệm người dùng, 181BET đã nhanh chóng trở thành một trong những lựa chọn hàng đầu của những ai yêu thích các hoạt động giải trí trực tuyến. Nền tảng này cung cấp một loạt các trò chơi và hoạt động tương tác đa dạng, giúp người tham gia có thể thư giãn, giải trí và tận hưởng những giây phút thư thái. Các trò chơi được thiết kế một cách sáng tạo, kết hợp giữa tính giải trí cao và độ thử thách, tạo ra không gian thú vị cho người chơi. Bên cạnh đó, 181BET cũng chú trọng đến việc tạo ra một môi trường an toàn và bảo mật cao, giúp người dùng có thể hoàn toàn yên tâm khi tham gia vào các hoạt động giải trí trực tuyến mà không lo ngại về sự an toàn thông tin cá nhân hay giao dịch.

Điều làm nên sự khác biệt của 181BET chính là khả năng tạo ra một cộng đồng gắn kết và thân thiện, nơi mà người tham gia không chỉ có thể tham gia vào các trò chơi mà còn có thể giao lưu, kết nối và chia sẻ những khoảnh khắc vui vẻ. Nền tảng này cung cấp không chỉ những trò chơi đơn giản mà còn những hoạt động tương tác xã hội, giúp mọi người có thể giao lưu với nhau, học hỏi và tạo ra những mối quan hệ mới. Các tính năng giao lưu được thiết kế để mọi người có thể dễ dàng kết nối và chia sẻ với nhau, tạo ra một cộng đồng trực tuyến thân thiện và đầy sức sống. Mỗi thành viên có thể tham gia vào các hoạt động nhóm, trò chuyện và kết bạn với những người có cùng sở thích, từ đó xây dựng một mạng lưới bạn bè trực tuyến. Bên cạnh đó, 181BET còn cung cấp các tính năng nâng cao, giúp người dùng có thể dễ dàng theo dõi tiến trình và thành tích của mình trong các trò chơi, từ đó tạo động lực cho người tham gia tiếp tục khám phá và trải nghiệm những thử thách mới.

Ngoài những tính năng vượt trội về giải trí và kết nối cộng đồng, 181BET còn chú trọng đến việc bảo vệ quyền lợi và bảo mật cho người sử dụng. Nền tảng này sử dụng công nghệ bảo mật tiên tiến để đảm bảo rằng mọi thông tin cá nhân và giao dịch đều được bảo vệ một cách nghiêm ngặt. Các hệ thống mã hóa dữ liệu và bảo vệ thông tin giúp người dùng yên tâm tham gia vào các hoạt động mà không lo lắng về việc bị lộ thông tin cá nhân hay gặp phải các vấn đề bảo mật. Đặc biệt, 181BET luôn nỗ lực nâng cấp hệ thống bảo mật để phù hợp với các tiêu chuẩn cao nhất của ngành công nghệ hiện nay, tạo nên một môi trường giải trí trực tuyến an toàn và đáng tin cậy. Bên cạnh đó, nền tảng này còn cung cấp dịch vụ hỗ trợ khách hàng 24/7, sẵn sàng giải đáp mọi thắc mắc và giúp đỡ người tham gia trong suốt quá trình trải nghiệm. Với đội ngũ nhân viên hỗ trợ chuyên nghiệp và tận tâm, 181BET cam kết mang đến cho người dùng một trải nghiệm trực tuyến mượt mà và không gặp phải bất kỳ trở ngại nào. Sự kết hợp giữa công nghệ bảo mật hiện đại, dịch vụ hỗ trợ khách hàng tận tình và một nền tảng giải trí đa dạng đã giúp 181BET trở thành một lựa chọn lý tưởng cho những ai tìm kiếm một không gian giải trí trực tuyến chất lượng và an toàn.

@ 7bdef7be:784a5805

We value sovereignty, privacy and security when accessing online content, using several tools to achieve this, like open protocols, open OSes, open software products, Tor and VPNs.

The problem

Talking about our social presence, we can manually build up our follower list (social graph), pick a Nostr client that is respectful of our preferences on what to show and how, but with the standard following mechanism, our main feed is public, so everyone can actually snoop what we are interested in, and what is supposable that we read daily.

The solution

Nostr has a simple solution for this necessity: encrypted lists. Lists are what they appear, a collection of people or interests (but they can also group much other stuff, see NIP-51). So we can create lists with contacts that we don't have in our main social graph; these lists can be used primarily to create dedicated feeds, but they could have other uses, for example, related to monitoring. The interesting thing about lists is that they can also be encrypted, so unlike the basic following list, which is always public, we can hide the lists' content from others. The implications are obvious: we can not only have a more organized way to browse content, but it is also really private one.

One might wonder what use can really be made of private lists; here are some examples:

• Browse “can't miss” content from users I consider a priority;
• Supervise competitors or adversarial parts;
• Monitor sensible topics (tags);
• Following someone without being publicly associated with them, as this may be undesirable;

The benefits in terms of privacy as usual are not only related to the casual, or programmatic, observer, but are also evident when we think of how many bots scan our actions to profile us.

The current state

Unfortunately, lists are not widely supported by Nostr clients, and encrypted support is a rarity. Often the excuse to not implement them is that they are harder to develop, since they require managing the encryption stuff (NIP-44). Nevertheless, developers have an easier option to start offering private lists: give the user the possibility to simply mark them as local-only, and never push them to the relays. Even if the user misses the sync feature, this is sufficient to create a private environment.

To date, as far as I know, the best client with list management is Gossip, which permits to manage both encrypted and local-only lists.

Beg your Nostr client to implement private lists!

@ 9ca447d2:fbf5a36d

Oregon has officially signed Senate Bill 167 (SB 167) into law, making digital assets, including bitcoin, legal collateral in financial transactions.

Governor Tina Kotek signed the bill on May 7, updating Oregon’s Uniform Commercial Code (UCC) to allow the use of digital assets like bitcoin as collateral in secured lending.

It adds Article 12, which outlines the legal framework for “controllable electronic records” which includes digital assets, tokenized records and electronic money.

SB 167 says digital assets can be used just like traditional collateral. That means individuals and businesses can use bitcoin or other digital assets to secure loans or financial agreements.

Before this, there was a lot of uncertainty. Companies and financial institutions weren’t sure how bitcoin would fit into the law, especially when it came to using it in commercial contracts. Now SB 167 removes that doubt.

It also updates Article 9 of the UCC to allow digital assets such as bitcoin as collateral in secured transactions. It also recognizes electronic records, electronic signatures and hybrid transactions, opening up more blockchain-based business activity.

This gives important legal clarity which could encourage more institutional investors to enter and participate in the market with more confidence.

Oregon is now one of the first states in the U.S. to clearly define and support the use of digital assets in the legal and financial systems. Analysts say it could trigger similar moves across the country.

In fact, the momentum is already building. Arizona and New Hampshire have already passed significant bitcoin-related bills this week.

In Arizona, Governor Katie Hobbs received a lot of criticism after vetoing Bill SB 1025.

After that, she was presented with another bitcoin-related bill—House Bill 2749— which she did sign into law, creating a state-run “Bitcoin and Digital Asset Reserve.”

This new fund allows the state to take custody of unclaimed digital assets after 3 years of inactivity and use them to generate value through staking or airdrops.

Jeff Weninger, Chair of the Arizona House Commerce Committee, said, “Digital assets aren’t the future—they’re the present. We’ve built a structure that protects property rights, respects ownership, and gives the state tools to account for a new category of value in the economy.”

Bitcoin Laws on X

Arizona also has another bill, Senate Bill 1373, pending with the governor. If signed, it will allow Arizona’s treasurer to allocate up to 10% of the Budget Stabilization Fund into bitcoin, turning it into a strategic financial hedge.

Arozina SB1373 is now at Chamber 2 — BitcoinLaws

And above all that, New Hampshire became the first state in the U.S. to legally enable the creation of a Strategic Bitcoin Reserve (SBR) thanks to House Bill 302.

These developments show that state governments are starting to take bitcoin seriously, not just as a speculative asset, but as part of the formal financial and legal system.

Another Oregon bill, House Bill 2071, has also been introduced.

It seeks to protect the rights of individuals and businesses to use digital assets for lawful payments and peer-to-peer transactions. Although still in early stages, the bill shows Oregon’s growing interest in blockchain and bitcoin innovation.

@ 1c19eb1a:e22fb0bc

What is #Nostrversity? It's where you can come to learn about all the great tools, clients, and amazing technology that is being built on #Nostr, for Nostr, or utilized by Nostr, presented in an approachable and non-technical format. If you have ever wondered what Blossom, bunker signing, or Nostr Wallet Connect are, how they work, and how you can put them to work to improve your Nostr experience, this is the place you can read about them without needing a computer-science degree ahead of time.

Between writing full-length reviews, which take a fair amount of time to research, test, and draft, I will post shorter articles with the Nostrversity hashtag to provide a Nostr-native resource to help the community understand and utilize the tools our illustrious developers are building. These articles will be much shorter, and more digestible than my full-length reviews. They will also cover some things that may not be quite ready for prime-time, whereas my reviews will continue to focus on Nostr apps that are production-ready.

Keep an eye out, because Nostr Wallet Connect will be the first topic of study. Take your seats, get out your notepads, and follow along to discover how Nostr Wallet Connect is improving Lightning infrastructure. Hint: It's not just for zaps.

@ a296b972:e5a7a2e8

***Satiretüchtigkeit***

Deutschland hat den Satirikern den Krieg erklärt, in dem es Realitäten schafft, die die Phantasie der Autoren überbieten soll. Dazu hat das neu geschaffene Satireministerium die Satiretüchtigkeit ganz oben auf die Agenda gesetzt.

***Notlage***

Die Notlage in Deutschland ist in eine Notlage geraten. Das Ausrufen einer Notlage ist Gebot der Stunde, in der die Notlage der Notlage bekämpft werden kann.

***Grenzsicherung***

Nachdem als eine der ersten Amtshandlungen die deutschen Außengrenzen neu vermessen worden sind, hat sich herausgestellt, dass die Grenzen nur gesichert offenbleiben können. Der Bundesgrenzschutz hat ab sofort die Aufgabe übernommen, ausländisches CO2 an der Grenze aufzuhalten.

***Demokratiebeleidigungsparagraph***

Nach intensiver Recherche des Verfassungsschutzes hat sich herausgestellt, dass die Opposition die seinerzeitige Bundesregierung als „Diktatur“ und „totalitär“ bezeichnet hat. Das ist Demokratiebeleidigung. Ein neuer Paragraph ist bereits in der Ausarbeitung.

***Einhaltung des Koalitionsvertrags***

Aus gesicherten Quellen ist durchgesickert, dass der erste Bundeskanzler zweiter Wahl nun doch nicht sein Amt wahrnehmen will, weil das so nicht im Koalitionsvertrag steht. Schließlich halte man sich an selbigen und die Glaubwürdigkeit dürfe unter keinen Umständen infrage gestellt werden.

***Bundesamt für Fassungslosigkeit***

Das Bundesamt für Verfassungsschutz soll nach dem Willen der Bürger in Bundesamt für Fassungslosigkeit umbenannt werden. Es soll ein deutliches Zeichen gesetzt werden, dass Bürgerbeteiligung in Zukunft ein wichtiger Bestandteil der Politik sein wird.

***Brüssel – Zentrum Belgiens***

Der Bundeskanzler mit Blackrock-Hintergrund hat als eine seiner ersten Amtshandlungen die Neugestaltung des Finanzmarktes in Brüssel angeregt. Der Euro soll in den allermeisten Europäischen Staaten durch den Blackrock-Taler ersetzt werden.

***Salutokratie***

Die WHO hat größte Zustimmung bei der Einführung der Salutokratie erfahren. Die Europäer jubeln und ziehen zu Tausenden mit der EU-Fahne durch die europäischen Hauptstädte. Auf vielen Plakaten ist der folgende Text zu lesen: Die Pharmaindustrie ist ein wichtiger Wirtschaftszweig. Durch unsere Erkrankungen tragen wir einen wichtigen Teil dazu bei, dass sie zu unserem Wohle weiter forschen und neue Medikamente auf den Markt bringen kann.

***Elektronische Patientenakte***

Nach für die Ärzte verpflichtender Einführung der elektronischen Patientenakte konnten letzte Lücken in der Datenoffenheit beseitigt werden. Eine vollständige Transparenz ist jetzt für jedermann gewährleistet. Die Krankenkassen jubeln, weil Ferndiagnosen noch effizienter praktiziert werden können.

***Übermenschliche Leistungen***

Die neue Wirtschaftsministerin hat ihre eigene Messlatte sehr hoch angelegt. Sie will die übermenschlichen Leistungen ihres Vorgängers noch übermenschlicher übertreffen. Ihre Mitarbeiter arbeiten fieberhaft an einer neuen Wortschöpfung, die über den Begriff Übermenschlichkeit hinausgeht. Es ist größte Eile geboten, da eine Neuwahl der Regierung schon in den nächsten Monaten zu erwarten ist.

***Lieferprobleme***

Der brutale Umzug der ehemaligen Außen-Dings in die genderunfreundlichen USA verzögert sich, weil ein bekanntes Versandunternehmen die Lieferkette von feministischen Umzugskartons nicht nachweisen kann. Außerdem wurde von Lagerengpässen für die bevorstehende Auslieferung mobiler Toiletten nach Afrika berichtet.

***Erwischt***

Der ehemalige Corona-Minister II. wurde auf der Rückfahrt nach Berlin (1. Klasse, die ist noch pünktlich) dabei gesehen, wie er im Bistro-Wagen mit Genuss eine leicht versalzene Bockwurst gegessen hat. Nach Ankunft in Berlin musste der Vorrat an erlesenem, durstlöschendem Rotwein aufgefüllt werden.

***Verkauf aus Gewissensgründen***

Der Corona-Minister I. bekannt und berühmt geworden durch seine kaufmännisch geschickt eingefädelten Masken-Deals in bedarfsgerechter Anzahl, sucht derzeit nach einem Käufer für seine bescheidene Hütte in Hamburg, weil er mit dem Erlös den bankkaufmanntechnischen Gewinnüberhang ausgleichen will.

***Drohnennahverkehr***

Das zu verstaatlichende Staatsunternehmen Bahn will spätestens 2028 den Drohnennahverkehr im Halbstundentakt bundesweit einführen. In einer Pressekonferenz wurde bekannt, dass man mit den Logistikfragen im Umgang mit den angeschlossenen Glasfaserkabeln schon sehr große Fortschritte gemacht habe.

***Merz-Frisur***

Vollhaar-Inhaber in der CDU wollen sich zur Unterstützung und als Zeichen der Loyalität eine Merz-Frisur bei einem bekannten Star-Friseur schneiden lassen. Die Wartezeiten betragen derzeit rund 5 Tage. Die Friseur-Innung arbeitet an einem Schnellkurs: Merz-Frisur-tüchtig in drei Wochen!

***Bestsellerliste***

Die ehemalige Bundesmutti hat weitere Prosa in zwei Bänden angekündigt: Die Titel lauten „Einigkeit“ und „Recht“. Derzeit laufen die Maschinen der papierverarbeitenden Hygieneindustrie auf Hochtouren (gut für die Wirtschaft!), da die Bestellliste schon 1000 Seiten lang ist, die jedoch aufgrund der Gleichbehandlung nicht veröffentlicht werden kann.

***Autoindustrie mehrheitlich positiv***

Die Umsätze der deutschen Autoindustrie sollen angeblich um rund 30% eingebrochen sein. Das bedeutet, dass die Mehrheit, also rund 70% noch vorhanden ist, was für die Wirtschaft allgemein sehr gute Nachrichten sind. Außerdem können freie Kapazitäten jetzt zur Produktion von Tankfahrzeugen für Panzer genutzt werden.

***Unterbringungsprobleme gelöst***

Durch die anhaltende Insolvenzwelle deutscher Unternehmen werden Werkshallen frei, die in kürzester Zeit zu weltoffenen Unterkünften umgebaut werden. Erfahrungen aus der Plattenbauweise der ehemaligen DDR konnten hier erfolgreich eingesetzt werden.

***Pandemiebekämpfung***

Deutschland ist zepterhaltend in Präventionsmaßnahmen für zukünftig geplante Pandemien. Federführend soll das virenverseuchte Bargeld stufenweise abgeschafft werden. Ein neues Panik-Paper sieht bereits seiner gut durchdachten Vollendung entgegen.

***Verband der Schreib-Fachkräfte***

Der in Anlehnung des bekannten Satzes von Peter Scholl-Latour formulierte Satz: -Wer Begriffe wie „Kriegstüchtigkeit“ und „Hass und Hetze“ aus dunklen Zeiten verwendet, wird selbst zur dunklen Zeit-, wurde vom Verband der Schreib-Fachkräfte als umstritten eingeordnet.

***Leitkultur***

Experten für den unfallfreien Verzehr von Bananen haben in einer teleskopierten Studie herausgefunden, dass das Wort Leitkultur aus den Worten Leitkuh und Kultur künstlich in einem französischen Labor für Gain-of-Word-Forschung zusammengesetzt wurde. Beweis dafür ist das fehlende Ha, das so in der Natur nicht vorkommt. Der Laborsprung konnte so eindeutig nachgewiesen werden.

***Reformvorschlag***

Bisher galt: Alle Bürgerrechte sind Abwehrrechte gegen den Staat. In einer Ausschusstagung soll jetzt darüber befunden werden, ob diese Formulierung aus Gründen der Delegitimierung des Staates nicht geändert werden kann. Der Reformvorschlag lautet: In einer angestrebten Unseredemokratie soll die Hoheit über die Abwehrrechte der Bürger beim Staat liegen. In demokratischen Einzelverfahren soll darüber entschieden werden, wann und in welchem Umfang sie gegen die Bürger zur Anwendung kommen sollen.

Dieser Artikel wurde mit dem Pareto-Client geschrieben

* *

(Bild von pixabay)

@ c9badfea:610f861a

1. Install FUTO Keyboard (it's free and open source)
2. Launch the app, tap Switch Input Methods and select FUTO Keyboard
3. For voice input, choose FUTO Keyboard (needs mic permission) and grant permission While Using The App
4. Configure keyboard layouts under Languages & Models as needed

Adding Support for Non-English Languages

Voice Input

1. Download voice input models from the FUTO Keyboard Add-Ons page
   • For languages like Chinese, German, Spanish, Russian, French, Portuguese, Korean, and Japanese, download the Multilingual-74 model
   • For other languages, download Multilingual-244
2. Open FUTO Keyboard, go to Languages & Models, and import the downloaded model under Voice Input

Dictionaries

1. Get dictionary files from AOSP Dictionaries
2. Open FUTO Keyboard, navigate to Languages & Models, and import the dictionary under Dictionary

ℹ️ When typing, tap the microphone icon to use voice input

@ 2e8970de:63345c7a

What gear are you using? Any new/used stuff you are currently trying to buy/sell?

originally posted at https://stacker.news/items/976340

@ 04c915da:3dfbecc9

Bitcoin has always been rooted in freedom and resistance to authority. I get that many of you are conflicted about the US Government stacking but by design we cannot stop anyone from using bitcoin. Many have asked me for my thoughts on the matter, so let’s rip it.

Concern

One of the most glaring issues with the strategic bitcoin reserve is its foundation, built on stolen bitcoin. For those of us who value private property this is an obvious betrayal of our core principles. Rather than proof of work, the bitcoin that seeds this reserve has been taken by force. The US Government should return the bitcoin stolen from Bitfinex and the Silk Road.

Usually stolen bitcoin for the reserve creates a perverse incentive. If governments see a bitcoin as a valuable asset, they will ramp up efforts to confiscate more bitcoin. The precedent is a major concern, and I stand strongly against it, but it should be also noted that governments were already seizing coin before the reserve so this is not really a change in policy.

Ideally all seized bitcoin should be burned, by law. This would align incentives properly and make it less likely for the government to actively increase coin seizures. Due to the truly scarce properties of bitcoin, all burned bitcoin helps existing holders through increased purchasing power regardless. This change would be unlikely but those of us in policy circles should push for it regardless. It would be best case scenario for American bitcoiners and would create a strong foundation for the next century of American leadership.

Optimism

The entire point of bitcoin is that we can spend or save it without permission. That said, it is a massive benefit to not have one of the strongest governments in human history actively trying to ruin our lives.

Since the beginning, bitcoiners have faced horrible regulatory trends. KYC, surveillance, and legal cases have made using bitcoin and building bitcoin businesses incredibly difficult. It is incredibly important to note that over the past year that trend has reversed for the first time in a decade. A strategic bitcoin reserve is a key driver of this shift. By holding bitcoin, the strongest government in the world has signaled that it is not just a fringe technology but rather truly valuable, legitimate, and worth stacking.

This alignment of incentives changes everything. The US Government stacking proves bitcoin’s worth. The resulting purchasing power appreciation helps all of us who are holding coin and as bitcoin succeeds our government receives direct benefit. A beautiful positive feedback loop.

Realism

We are trending in the right direction. A strategic bitcoin reserve is a sign that the state sees bitcoin as an asset worth embracing rather than destroying. That said, there is a lot of work left to be done. We cannot be lulled into complacency, the time to push forward is now, and we cannot take our foot off the gas. We have a seat at the table for the first time ever. Let's make it worth it.

We must protect the right to free usage of bitcoin and other digital technologies. Freedom in the digital age must be taken and defended, through both technical and political avenues. Multiple privacy focused developers are facing long jail sentences for building tools that protect our freedom. These cases are not just legal battles. They are attacks on the soul of bitcoin. We need to rally behind them, fight for their freedom, and ensure the ethos of bitcoin survives this new era of government interest. The strategic reserve is a step in the right direction, but it is up to us to hold the line and shape the future.

@ 629c4a12:f822cc1a

I’ve always been drawn to minimalism. There’s a certain peace that comes from stripping away the unnecessary, decluttering both physical and mental spaces. Yet, when it comes to finances, I’ve found myself tangled in complexity. As an ‘optimizer,’ I spend an inordinate amount of time thinking about investments, managing risk, and endlessly tinkering with my portfolio. This preoccupation contradicts the minimalist principles I try to live by.

It seems absurd to me that the financial world has become so complicated that we need money managers to simply preserve the value of our money. If investing is so intricate that the average person must hire professionals just to preserve (let alone grow) the value of their savings, then something is fundamentally wrong.

For the past five years, I’ve immersed myself in the history and mechanics of financial systems. The deeper I delved, the clearer it became: Bitcoin is a force of minimalism in an increasingly financialized and complex world.

The Clutter of Modern Finance

Our financial system has become bloated with complexity. The hyper-securitization of assets has created an environment filled with financial clutter. Derivatives, for example, represent layers upon layers of financial engineering, often so convoluted that even experts struggle to understand them fully.

More troubling is the way nearly everything of value has been financialized. Real estate and art, two things that should embody personal value and cultural significance, have been transformed into mere asset classes. They are bought, sold, and speculated upon not for their intrinsic qualities but as instruments in the game of wealth preservation.

But why has this happened? It’s actually quite simple: our money is constantly losing value. The dollar, for example, debases at a rate of around 7% per year. Holding cash feels like holding melting ice, so it’s only natural for people to seek out scarce assets to preserve their wealth. The Never-Ending Game of Diversification

This pursuit of scarce assets sets off a complex game—a game that forces people to diversify endlessly:

• Equities
• Bonds
• Real Estate
• Commodities
• Art
• Collectibles

We’re told to spread our investments across these asset classes to mitigate risk and preserve our hard-earned money. Those who can afford to hire money managers generally fare better in this game, as they have access to expertise and strategies designed to navigate this maze of complexity.

Ironically, this system creates an incentive for more complexity. The more convoluted the financial landscape becomes, the more we need money managers, and the more entrenched this cycle of financialization and securitization becomes. It’s a force of ever-increasing entropy—quite the opposite of minimalism.

Bitcoin: Simplicity in a Complex World

In the midst of this financial chaos, Bitcoin emerges as a beacon of simplicity. It offers a way out of the clutter, a chance to reclaim financial minimalism. Bitcoin embodies the concept of scarcity with a rare kind of perfection: there will only ever be 21 million Bitcoins. No more.

This scarcity makes Bitcoin the perfect savings technology. Unlike traditional currencies, no one can debase your holdings. You don’t need to chase after real estate, art, or other assets to preserve your wealth. You don’t need to constantly diversify and rebalance a portfolio to stay ahead of inflation. Bitcoin’s scarcity gives you a way to hold your wealth securely, without the need for endless tinkering.

I’m not blind to Bitcoin’s short-term price volatility. However, it’s crucial to understand that we’re still in the early stages of adoption. As more people embrace this perfect form of scarcity, Bitcoin’s qualities as savings technology will express itself.

Bitcoin has the potential to de-financialize the housing market. It can de-financialize art.

Ultimately, Bitcoin has the power to replace those aspects of our lives that currently serve as proxies for scarcity.

A Minimalist Approach to Wealth

Bitcoin allows us to step off the treadmill of constant financial optimization. It offers a simpler way to safeguard the fruits of our labor. Rather than spending our time, energy, and attention on navigating a complex financial system, we can focus on what truly matters: living a meaningful life.

By embracing Bitcoin, we embrace a minimalist approach to wealth. We reject the idea that we must play a never-ending game of diversification to maintain our standard of living. Instead, we adopt a simple, elegant solution that aligns with the principles of minimalism.

Conclusion

In a world that grows more financially cluttered by the day, Bitcoin stands as a path to financial minimalism. It frees us from the complexities of traditional finance, allowing us to preserve our wealth without the need for constant vigilance and management.

By embodying scarcity and simplicity, Bitcoin gives us a way to reclaim our time and energy. It’s not just a financial tool; it’s a way to simplify our lives, to step back from the chaos, and to focus on what truly matters

@ 7459d333:f207289b

Description: Just as Bitcoin enabled sovereignty over money, a decentralized shipping protocol would enable sovereignty over trade. An LN/Bisq inspired shipping protocol could create an unstoppable free market.

---

Bitcoin gave us monetary sovereignty, freeing us from central bank manipulation, inflation, and censorship. But there's a missing link in our freedom journey: the physical world of goods.

The Problem: Even with Bitcoin, global trade remains at the mercy of: - Arbitrary tariffs and import restrictions - Political censorship of goods - Privacy invasion of shipping information - Centralized shipping carriers

The Vision: A decentralized shipping protocol with these properties:

• "Onion-routed" packages: Each carrier only knows the previous and next hop
• Bitcoin-secured multi-sig escrow: Funds locked until package delivery confirmed
• Incentive alignment: Carriers set their own fees based on risk assessment
• Privacy tiers: Options for inspected vs. sealed packages with appropriate pricing
• End-to-end sovereignty: Sender and receiver maintain control, intermediate carriers just fulfill their role

How it could work:

1. Sender creates shipping request with package details and destination
2. Protocol finds optimal route through independent carriers
3. Each hop secured by multi-sig deposits larger than package value
4. Carriers only see next hop, not ultimate destination
5. Reputation systems and economic incentives maintain integrity

This creates a free market where any individual can participate as a carrier, earning Bitcoin for facilitating trade. Just like Lightning Network nodes, anyone can open "channels" with trusted partners.

Impact: This would enable true free market principles globally, making artificial trade barriers obsolete and empowering individuals to engage in voluntary exchange regardless of geographic or political boundaries.

There are a lot of challenges. But the first question is if this is a real problem and if its worth solving it.

What components would need development first? How would you solve the physical handoff challenges?

originally posted at https://stacker.news/items/976326

@ d23af4ac:7bf07adb

This is a test-note published directly from Obsidian

Heading 1

Some paragraph text [^2]

Heading 2

Second paragraph text. * List item 1 * List item 2

js console.log("Hello world!")

Json

json { name: "Alise", age: 45 }

[!SCRUNCHABLE NOTE]- This should be collapsed when the page first loads. This should be collapsed when the page first loads. This should be collapsed when the page first loads. This should be collapsed when the page first loads. This should be collapsed when the page first loads. This should be collapsed when the page first loads. This should be collapsed when the page first loads. This should be collapsed when the page first loads. This should be collapsed when the page first loads. This should be collapsed when the page first loads.

[!DANGER] This is a "danger" type message. Should be properly formateed. This is a "danger" type message. Should be properly formateed. This is a "danger" type message. Should be properly formateed. This is a "danger" type message. Should be properly formateed. This is a "danger" type message. Should be properly formateed.

--

Pasted image:

![[Pasted image 20250218120714.png]]

This is a blockquote. This is a blockquote. This is a blockquote. This is a blockquote. This is a blockquote. This is a blockquote. This is a blockquote. This is a blockquote[^1]. This is a blockquote. This is a blockquote. This is a blockquote. This is a blockquote. This is a blockquote. This is a blockquote. This is a blockquote. This is a blockquote.

• [x] This is a completed task
• [ ] This is an uncompleted task
• [ ] This is also an uncompleted task

[!QUESTION] Will this inline code format properly? console.log('Yo momma so fat she took a spoon to the Super Bown'); Idk...

[^1]: Footnotes also supported? Even inside blockquotes? [^2]: Footnote in regular paragraph

@ c631e267:c2b78d3e

Information ohne Reflexion ist geistiger Flugsand. \ Ernst Reinhardt

Der lateinische Ausdruck «Quo vadis» als Frage nach einer Entwicklung oder Ausrichtung hat biblische Wurzeln. Er wird aber auch in unserer Alltagssprache verwendet, laut Duden meist als Ausdruck von Besorgnis oder Skepsis im Sinne von: «Wohin wird das führen?»

Der Sinn und Zweck von so mancher politischen Entscheidung erschließt sich heutzutage nicht mehr so leicht, und viele Trends können uns Sorge bereiten. Das sind einerseits sehr konkrete Themen wie die zunehmende Militarisierung und die geschichtsvergessene Kriegstreiberei in Europa, deren Feindbildpflege aktuell beim Gedenken an das Ende des Zweiten Weltkriegs beschämende Formen annimmt.

Auch das hohe Gut der Schweizer Neutralität scheint immer mehr in Gefahr. Die schleichende Bewegung der Eidgenossenschaft in Richtung NATO und damit weg von einer Vermittlerposition erhält auch durch den neuen Verteidigungsminister Anschub. Martin Pfister möchte eine stärkere Einbindung in die europäische Verteidigungsarchitektur, verwechselt bei der Argumentation jedoch Ursache und Wirkung.

Das Thema Gesundheit ist als Zugpferd für Geschäfte und Kontrolle offenbar schon zuverlässig etabliert. Die hauptsächlich privat finanzierte Weltgesundheitsorganisation (WHO) ist dabei durch ein Netzwerk von sogenannten «Collaborating Centres» sogar so weit in nationale Einrichtungen eingedrungen, dass man sich fragen kann, ob diese nicht von Genf aus gesteuert werden.

Das Schweizer Bundesamt für Gesundheit (BAG) übernimmt in dieser Funktion ebenso von der WHO definierte Aufgaben und Pflichten wie das deutsche Robert Koch-Institut (RKI). Gegen die Covid-«Impfung» für Schwangere, die das BAG empfiehlt, obwohl es fehlende wissenschaftliche Belege für deren Schutzwirkung einräumt, formiert sich im Tessin gerade Widerstand.

Unter dem Stichwort «Gesundheitssicherheit» werden uns die Bestrebungen verkauft, essenzielle Dienste mit einer biometrischen digitalen ID zu verknüpfen. Das dient dem Profit mit unseren Daten und führt im Ergebnis zum Verlust unserer demokratischen Freiheiten. Die deutsche elektronische Patientenakte (ePA) ist ein Element mit solchem Potenzial. Die Schweizer Bürger haben gerade ein Referendum gegen das revidierte E-ID-Gesetz erzwungen. In Thailand ist seit Anfang Mai für die Einreise eine «Digital Arrival Card» notwendig, die mit ihrer Gesundheitserklärung einen Impfpass «durch die Hintertür» befürchten lässt.

Der massive Blackout auf der iberischen Halbinsel hat vermehrt Fragen dazu aufgeworfen, wohin uns Klimawandel-Hysterie und «grüne» Energiepolitik führen werden. Meine Kollegin Wiltrud Schwetje ist dem nachgegangen und hat in mehreren Beiträgen darüber berichtet. Wenig überraschend führen interessante Spuren mal wieder zu internationalen Großbanken, Globalisten und zur EU-Kommission.

Zunehmend bedenklich ist aber ganz allgemein auch die manifestierte Spaltung unserer Gesellschaften. Angesichts der tiefen und sorgsam gepflegten Gräben fällt es inzwischen schwer, eine zukunftsfähige Perspektive zu erkennen. Umso begrüßenswerter sind Initiativen wie die Kölner Veranstaltungsreihe «Neue Visionen für die Zukunft». Diese möchte die Diskussionskultur reanimieren und dazu beitragen, dass Menschen wieder ohne Angst und ergebnisoffen über kontroverse Themen der Zeit sprechen.

Quo vadis – Wohin gehen wir also? Die Suche nach Orientierung in diesem vermeintlichen Chaos führt auch zur Reflexion über den eigenen Lebensweg. Das ist positiv insofern, als wir daraus Kraft schöpfen können. Ob derweil der neue Papst, dessen «Vorgänger» Petrus unsere Ausgangsfrage durch die christliche Legende zugeschrieben wird, dabei eine Rolle spielt, muss jede/r selbst wissen. Mir persönlich ist allein schon ein Führungsanspruch wie der des Petrusprimats der römisch-katholischen Kirche eher suspekt.

[Titelbild: Pixabay]

---

Dieser Beitrag wurde mit dem Pareto-Client geschrieben und ist zuerst auf Transition News erschienen.

@ a3c6f928:d45494fb

In today's hyper-connected world, the concept of freedom has taken on new dimensions. With every click, swipe, and search, we contribute to a vast digital footprint that shapes how we are seen and how we interact with the world. But as technology advances, so too does the tension between digital convenience and the right to personal privacy.

The Digital Landscape

The rise of the internet has democratized information, connecting billions of people across the globe. Social media platforms allow for unprecedented levels of communication, giving a voice to the voiceless and a platform for activism. However, this connectivity comes with a price—our personal information.

The Cost of Convenience

From targeted ads to personalized recommendations, our online behaviors are tracked, analyzed, and sometimes exploited. While this can enhance user experience, it also raises questions about how much of our freedom is being surrendered in exchange for convenience. Are we willingly giving up our privacy for the sake of digital ease?

Privacy vs. Security

Governments and corporations argue that data collection is necessary for security and better services. However, this often blurs the lines between protection and intrusion. When is it acceptable for private information to be shared, and where should the boundaries be drawn?

Protecting Digital Freedom

1. Know Your Rights: Understand the privacy policies of the platforms you use.

2. Use Encryption: Protect your personal communications with encrypted services.

3. Limit Data Sharing: Be mindful of the information you share online.

4. Support Digital Rights: Advocate for stronger data protection laws.

The Path Forward

As technology continues to evolve, so must our understanding of freedom in the digital realm. True digital freedom is not just about access; it is about control—control over our information, our choices, and our online identities.

---

“The price of freedom is eternal vigilance.” — Thomas Jefferson

In this digital age, that vigilance must extend to the virtual world, where our freedoms are just as valuable and just as fragile.

@ 1c197b12:242e1642

A Cypherpunk's Manifesto by Eric Hughes

Privacy is necessary for an open society in the electronic age. Privacy is not secrecy. A private matter is something one doesn't want the whole world to know, but a secret matter is something one doesn't want anybody to know. Privacy is the power to selectively reveal oneself to the world.

If two parties have some sort of dealings, then each has a memory of their interaction. Each party can speak about their own memory of this; how could anyone prevent it? One could pass laws against it, but the freedom of speech, even more than privacy, is fundamental to an open society; we seek not to restrict any speech at all. If many parties speak together in the same forum, each can speak to all the others and aggregate together knowledge about individuals and other parties. The power of electronic communications has enabled such group speech, and it will not go away merely because we might want it to.

Since we desire privacy, we must ensure that each party to a transaction have knowledge only of that which is directly necessary for that transaction. Since any information can be spoken of, we must ensure that we reveal as little as possible. In most cases personal identity is not salient. When I purchase a magazine at a store and hand cash to the clerk, there is no need to know who I am. When I ask my electronic mail provider to send and receive messages, my provider need not know to whom I am speaking or what I am saying or what others are saying to me; my provider only need know how to get the message there and how much I owe them in fees. When my identity is revealed by the underlying mechanism of the transaction, I have no privacy. I cannot here selectively reveal myself; I must always reveal myself.

Therefore, privacy in an open society requires anonymous transaction systems. Until now, cash has been the primary such system. An anonymous transaction system is not a secret transaction system. An anonymous system empowers individuals to reveal their identity when desired and only when desired; this is the essence of privacy.

Privacy in an open society also requires cryptography. If I say something, I want it heard only by those for whom I intend it. If the content of my speech is available to the world, I have no privacy. To encrypt is to indicate the desire for privacy, and to encrypt with weak cryptography is to indicate not too much desire for privacy. Furthermore, to reveal one's identity with assurance when the default is anonymity requires the cryptographic signature.

We cannot expect governments, corporations, or other large, faceless organizations to grant us privacy out of their beneficence. It is to their advantage to speak of us, and we should expect that they will speak. To try to prevent their speech is to fight against the realities of information. Information does not just want to be free, it longs to be free. Information expands to fill the available storage space. Information is Rumor's younger, stronger cousin; Information is fleeter of foot, has more eyes, knows more, and understands less than Rumor.

We must defend our own privacy if we expect to have any. We must come together and create systems which allow anonymous transactions to take place. People have been defending their own privacy for centuries with whispers, darkness, envelopes, closed doors, secret handshakes, and couriers. The technologies of the past did not allow for strong privacy, but electronic technologies do.

We the Cypherpunks are dedicated to building anonymous systems. We are defending our privacy with cryptography, with anonymous mail forwarding systems, with digital signatures, and with electronic money.

Cypherpunks write code. We know that someone has to write software to defend privacy, and since we can't get privacy unless we all do, we're going to write it. We publish our code so that our fellow Cypherpunks may practice and play with it. Our code is free for all to use, worldwide. We don't much care if you don't approve of the software we write. We know that software can't be destroyed and that a widely dispersed system can't be shut down.

Cypherpunks deplore regulations on cryptography, for encryption is fundamentally a private act. The act of encryption, in fact, removes information from the public realm. Even laws against cryptography reach only so far as a nation's border and the arm of its violence. Cryptography will ineluctably spread over the whole globe, and with it the anonymous transactions systems that it makes possible.

For privacy to be widespread it must be part of a social contract. People must come and together deploy these systems for the common good. Privacy only extends so far as the cooperation of one's fellows in society. We the Cypherpunks seek your questions and your concerns and hope we may engage you so that we do not deceive ourselves. We will not, however, be moved out of our course because some may disagree with our goals.

The Cypherpunks are actively engaged in making the networks safer for privacy. Let us proceed together apace.

Onward.

Eric Hughes hughes@soda.berkeley.edu

9 March 1993

@ d360efec:14907b5f

Disclaimer: * การวิเคราะห์นี้เป็นเพียงแนวทาง ไม่ใช่คำแนะนำในการซื้อขาย * การลงทุนมีความเสี่ยง ผู้ลงทุนควรตัดสินใจด้วยตนเอง

@ fd208ee8:0fd927c1

I am so tired of people trying to waste my time with Nostrized imitations of stuff that already exists.

Instagram, but make it Nostr. Twitter, but make it Nostr. GitHub, but make it Nostr. Facebook, but make it Nostr. Wordpress, but make it Nostr. GoodReads, but make it Nostr. TikTok, but make it Nostr.

That stuff already exists, and it wasn't that great the first time around, either. Build something better than that stuff, that can only be brought into existence because of Nostr.

Build something that does something completely and awesomely new. Knock my socks off, bro.

Cuz, ain't nobody got time for that.

@ 6d8e2a24:5faaca4c

North American nations have been at the forefront of Bitcoin adoption; however, Nigeria, Kenya and South Africa have recently emerged as leaders in Africa.

There’s an increasing acceptance of Bitcoin on the African continent. More businesses, individuals and even financial organizations are using cryptocurrency to transact as an alternative to traditional banking systems. With the economies of the continent experiencing a lot of currency instability, poor banking infrastructure and exorbitantly priced remittances, Bitcoin is coming up as a viable solution financially. Analyzing Bitcoin price trends is crucial for investors, traders and businesses in Africa who want to implement digital assets in their operations.

The Impact of Bitcoin on the African Economy

North American nations have been at the forefront of Bitcoin adoption; however, Nigeria, Kenya and South Africa have recently emerged as leaders in Africa. Peer-to-peer cryptocurrency trading across the continent reached over $100 billion in 2023, making Africa one of the fastest-growing markets for blockchain technology, according to a report by Chainalysis. Several factors that fuel this growth include:

⚪ Less Dependable Fiat Currency : Zimbabwe and Nigeria have poor liquidity currencies, which makes it prudent for citizens to invest in Bitcoin to minimize losses due to devaluation over time.

⚪ Payments for Foreign Worker Remittances: Bitcoin is useful for relocating payments since it eliminates the need for using bitcoin remittance centers that charge ridiculous fees for payment processing.

⚪ Financial Inclusion : A large portion of the African population does not use banks. This makes bitcoin an ideal alternative, as it offers a decentralized and unbanked-friendly option for conducting transactions.

How Bitcoin’s Price Trends Affect the African Market

Businesses and individuals’ activities with bitcoin are directly proportional to its price trends and different nations have different ways through which they analyze this. Take Nigeria, for instance, where the e-commerce platform Patricia and several local sellers on Jumia have had to change their prices multiple times a day to keep in line with the fluctuating value of bitcoin. This has led to the platform’s volatility driving the pricing strategy of freelancers and remote workers who are paid in bitcoin and the currency has to be converted before being spent. As investor sentiment increases, so too does Bitcoin’s value, reaching 71,333 dollars in April of 2024, according to estimates from CoinMarketCap. The volatility, however, remains high and so there is a lot of uncertainty for African investors and businesses hoping to capitalize on the price movement.

Amongst the factors that impact the price movement of bitcoin, these are the most significant:

⚪ Global Adoption and Institutional Investments: An increase in spending by corporations leads to a higher demand and price for bitcoin.

⚪ Regulatory Changes : The law about cryptocurrency in different African countries is a vital influencer of regard and value for bitcoin.

⚪ Market Speculation and Trading Activity: The volatility of Bitcoin's price remains dependent on investor sentiment, especially in the emerging markets.

African Governments and Cryptocurrency Regulation

The policies for regulating Bitcoin are different in various countries in Africa. While countries like South Africa and Kenya are skeptical but working towards adjusting their policies to incorporate cryptocurrency into their economies, other nations remain hesitant. The following is a summary of the most important changes:

⚪ South Africa: The Financial Sector Conduct Authority (FSCA) offered more structured regulations by classifying crypto assets as financial products. This is a notable development towards more stringent regulations.

⚪ Nigeria: The Central Bank of Nigeria has previously restricted banks from supporting the facilitation of crypto transactions but is in the process of allowing it due to newly offered licenses to cryptocurrency exchanges, which under certain guidelines allow them to conduct regulated crypto activities.

⚪ Kenya: The Capital Markets Authority is seeking ways to regulate the security features of Bitcoin to enable it to reduce fraud. Bitcoin’s Impact on E-commerce and Small Businesses in Africa

With the rise of cryptocurrency acceptance, small-scale businesses and e-commerce businesses are increasing the option of paying for goods and services in Bitcoin. Businesses can reduce costs by:

⚪ Decreased Transaction Fees: Payments made using Bitcoin are usually cheaper than those made through credit cards. For example, some merchants in Ghana are beginning to use Bitcoin to bypass high fee payment processing, increase their profit margins and improve overall business profitability.

⚪ Reduced Transaction Delays: Banking transactions processed through the blockchain do away with delays associated with traditional banking.

⚪ Access to Global Markets: Businesses in Africa have no issues engaging with foreign clients because there is no currency conversion needed.

For instance, Yellow Card is a cryptocurrency exchange that operates in several countries in Africa and allows the trading of Bitcoins. In 2024, Yellow Card received more compliance approvals, which allowed the business to serve more than 20 countries in Africa. It now stands as a central player in the regional ecosystem of crypto. The platform allows businesses or individuals to transact efficiently with Bitcoin.

Challenges and Risks of Bitcoin Adoption in Africa

Unlike the advantages, there are several challenges regarding the adoption of Bitcoin in Africa:

⚪ Regulatory Uncertainty: The considerable flux of policies is difficult for businesses and investors to navigate, although some countries are beginning to put clearer policies into place, such as South Africa and Nigeria. As an example, Nigeria has plans to regulate the exchange of digital assets and put some control over it through the issuing of licenses for crypto exchanges, which are expected to be released in 2024.

⚪ Price Volatility: Changes in the price of Bitcoin can affect savings and transactions for businesses.

⚪ Limited Infrastructure: Internet and computer skills are primary requirements for greater acceptance.

Conclusion

Bitcoin is increasingly becoming a key component of Africa’s financial ecosystem by providing banking services or alternatives, facilitating financial remittances and supporting inclusion. Experts expect that Africa will increasingly adopt Bitcoin as a major tool of payment and remittance service across borders and for digital financial transactions. This will be the case if the regulations supporting its growth are put in place. While price volatility and regulatory challenges persist, knowing how prices behave and the developments within the Bitcoin ecosystem will help investors and businesses understand the new economy Africa is adopting. Africa indeed has the chance to use strategic adoption of technology to improve economic development and innovation through Bitcoin if action is taken.

2025Content from a Premium Partner InfoWire https://allafrica.com/stories/202503240689.html

@ c1e9ab3a:9cb56b43

I. Historical Foundations of U.S. Monetary Architecture

The early monetary system of the United States was built atop inherited commodity money conventions from Europe’s maritime economies. Silver and gold coins—primarily Spanish pieces of eight, Dutch guilders, and other foreign specie—formed the basis of colonial commerce. These units were already integrated into international trade and piracy networks and functioned with natural compatibility across England, France, Spain, and Denmark. Lacking a centralized mint or formal currency, the U.S. adopted these forms de facto.

As security risks and the practical constraints of physical coinage mounted, banks emerged to warehouse specie and issue redeemable certificates. These certificates evolved into fiduciary media—claims on specie not actually in hand. Banks observed over time that substantial portions of reserves remained unclaimed for years. This enabled fractional reserve banking: issuing more claims than reserves held, so long as redemption demand stayed low. The practice was inherently unstable, prone to panics and bank runs, prompting eventual centralization through the formation of the Federal Reserve in 1913.

Following the Civil War and unstable reinstatements of gold convertibility, the U.S. sought global monetary stability. After World War II, the Bretton Woods system formalized the U.S. dollar as the global reserve currency. The dollar was nominally backed by gold, but most international dollars were held offshore and recycled into U.S. Treasuries. The Nixon Shock of 1971 eliminated the gold peg, converting the dollar into pure fiat. Yet offshore dollar demand remained, sustained by oil trade mandates and the unique role of Treasuries as global reserve assets.

II. The Structure of Fiduciary Media and Treasury Demand

Under this system, foreign trade surpluses with the U.S. generate excess dollars. These surplus dollars are parked in U.S. Treasuries, thereby recycling trade imbalances into U.S. fiscal liquidity. While technically loans to the U.S. government, these purchases act like interest-only transfers—governments receive yield, and the U.S. receives spendable liquidity without principal repayment due in the short term. Debt is perpetually rolled over, rarely extinguished.

This creates an illusion of global subsidy: U.S. deficits are financed via foreign capital inflows that, in practice, function more like financial tribute systems than conventional debt markets. The underlying asset—U.S. Treasury debt—functions as the base reserve asset of the dollar system, replacing gold in post-Bretton Woods monetary logic.

III. Emergence of Tether and the Parastatal Dollar

Tether (USDT), as a private issuer of dollar-denominated tokens, mimics key central bank behaviors while operating outside the regulatory perimeter. It mints tokens allegedly backed 1:1 by U.S. dollars or dollar-denominated securities (mostly Treasuries). These tokens circulate globally, often in jurisdictions with limited banking access, and increasingly serve as synthetic dollar substitutes.

If USDT gains dominance as the preferred medium of exchange—due to technological advantages, speed, programmability, or access—it displaces Federal Reserve Notes (FRNs) not through devaluation, but through functional obsolescence. Gresham’s Law inverts: good money (more liquid, programmable, globally transferable USDT) displaces bad (FRNs) even if both maintain a nominal 1:1 parity.

Over time, this preference translates to a systemic demand shift. Actors increasingly use Tether instead of FRNs, especially in global commerce, digital marketplaces, or decentralized finance. Tether tokens effectively become shadow base money.

IV. Interaction with Commercial Banking and Redemption Mechanics

Under traditional fractional reserve systems, commercial banks issue loans denominated in U.S. dollars, expanding the money supply. When borrowers repay loans, this destroys the created dollars and contracts monetary elasticity. If borrowers repay in USDT instead of FRNs:

• Banks receive a non-Fed liability (USDT).
• USDT is not recognized as reserve-eligible within the Federal Reserve System.
• Banks must either redeem USDT for FRNs, or demand par-value conversion from Tether to settle reserve requirements and balance their books.

This places redemption pressure on Tether and threatens its 1:1 peg under stress. If redemption latency, friction, or cost arises, USDT’s equivalence to FRNs is compromised. Conversely, if banks are permitted or compelled to hold USDT as reserve or regulatory capital, Tether becomes a de facto reserve issuer.

In this scenario, banks may begin demanding loans in USDT, mirroring borrower behavior. For this to occur sustainably, banks must secure Tether liquidity. This creates two options: - Purchase USDT from Tether or on the secondary market, collateralized by existing fiat. - Borrow USDT directly from Tether, using bank-issued debt as collateral.

The latter mirrors Federal Reserve discount window operations. Tether becomes a lender of first resort, providing monetary elasticity to the banking system by creating new tokens against promissory assets—exactly how central banks function.

V. Structural Consequences: Parallel Central Banking

If Tether begins lending to commercial banks, issuing tokens backed by bank notes or collateralized debt obligations: - Tether controls the expansion of broad money through credit issuance. - Its balance sheet mimics a central bank, with Treasuries and bank debt as assets and tokens as liabilities. - It intermediates between sovereign debt and global liquidity demand, replacing the Federal Reserve’s open market operations with its own issuance-redemption cycles.

Simultaneously, if Tether purchases U.S. Treasuries with FRNs received through token issuance, it: - Supplies the Treasury with new liquidity (via bond purchases). - Collects yield on government debt. - Issues a parallel form of U.S. dollars that never require redemption—an interest-only loan to the U.S. government from a non-sovereign entity.

In this context, Tether performs monetary functions of both a central bank and a sovereign wealth fund, without political accountability or regulatory transparency.

VI. Endgame: Institutional Inversion and Fed Redundancy

This paradigm represents an institutional inversion:

• The Federal Reserve becomes a legacy issuer.
• Tether becomes the operational base money provider in both retail and interbank contexts.
• Treasuries remain the foundational reserve asset, but access to them is mediated by a private intermediary.
• The dollar persists, but its issuer changes. The State becomes a fiscal agent of a decentralized financial ecosystem, not its monetary sovereign.

Unless the Federal Reserve reasserts control—either by absorbing Tether, outlawing its instruments, or integrating its tokens into the reserve framework—it risks becoming irrelevant in the daily function of money.

Tether, in this configuration, is no longer a derivative of the dollar—it is the dollar, just one level removed from sovereign control. The future of monetary sovereignty under such a regime is post-national and platform-mediated.

@ fbf0e434:e1be6a39

Hackathon 概要

Stellar Build Better Hackathon 已圆满落幕，共有 220 名注册开发者参与，84 个项目获得批准。本次活动旨在通过 Stellar 的智能合约推动实际应用，强调社区合作与技术进步。参赛者在三个类别中展开角逐，总奖金为 25000 美元的 USDC，类别包括：Better Finance、Better Creativity 和 Better Access。

开发者探索了 DeFi 可及性工具、跨境支付解决方案、创作者经济平台和身份解决方案等领域。Hackathon 为与全球开发者交流及知名加密公司曝光提供了契机。此外，还设有技术研讨会和现场 demo 环节，为参赛者提供支持。

在成果方面，一等奖 12,000 USDC 授予了提升金融可及性的项目。二、三等奖分别获得 8,000 和 5,000 USDC 的奖励，以表彰其在创意工具和可访问性解决方案方面的创新。通过这些奖励，此次活动凸显了 Stellar 在促进实用创新及扩展其生态系统中智能合约应用方面的作用。

Hackathon 获奖者

第一名

• PayZoll_Stellar - PayZoll 在 Stellar 生态系统中集成了AI和区块链，提供安全、自动化和透明的全球薪资服务，提升了薪资管理的效率和可靠性。

第二名

• StellarFinance - 该平台在Stellar区块链上促进用户与财务顾问之间的连接，提供专注于诚信和用户参与的安全透明的金融服务。

第三名

• Soroban to MCP Server in seconds + Policy Signers Playground - 此解决方案将Stellar Soroban智能合约转换为MCP服务器，实现自然语言交互，支持AI代理执行并增强智能合约功能。

前往 DoraHacks 查看参与hackathon的所有项目。

关于主办方

Stellar Development Foundation

Stellar Development Foundation 力求促进 Stellar 网络的增长和发展，这是一种旨在促进高效跨境交易的区块链平台。基金会专注于去中心化金融（DeFi），实施推进全球金融包容性的项目。通过与广泛的网络合作，该组织推广可扩展的区块链解决方案，确保金融服务的可及性和可靠性。其使命是通过创新的开源技术，为全球经济提供公平的通道。

@ 95543309:196c540e

:bob:

rant

why the fuck bunkers and stuff try to enctypt long text articles with nip 44

end rant

@ b8851a06:9b120ba1

It Begins with a Click

It starts with a click: “Do you agree to our terms and conditions?”\ You scroll, you click, you comply. A harmless act, right? But what if every click was a surrender? What if every "yes" was another link in the chain binding you to a life where freedom requires approval?

This is the age of permission. Every aspect of your life is mediated by gatekeepers. Governments demand forms, corporations demand clicks, and algorithms demand obedience. You’re free, of course, as long as you play by the rules. But who writes the rules? Who decides what’s allowed? Who owns your life?

---

Welcome to Digital Serfdom

We once imagined the internet as a digital frontier—a vast, open space where ideas could flow freely and innovation would know no bounds. But instead of creating a decentralized utopia, we built a new feudal system.

• Your data? Owned by the lords of Big Tech.
• Your money? Controlled by banks and bureaucrats who can freeze it on a whim.
• Your thoughts? Filtered by algorithms that reward conformity and punish dissent.

The modern internet is a land of serfs and lords, and guess who’s doing the farming? You. Every time you agree to the terms, accept the permissions, or let an algorithm decide for you, you till the fields of a system designed to control, not liberate.

They don’t call it control, of course. They call it “protection.” They say, “We’re keeping you safe,” as they build a cage so big you can’t see the bars.

---

Freedom in Chains

But let’s be honest: we’re not just victims of this system—we’re participants. We’ve traded freedom for convenience, sovereignty for security. It’s easier to click “I Agree” than to read the fine print. It’s easier to let someone else hold your money than to take responsibility for it yourself. It’s easier to live a life of quiet compliance than to risk the chaos of true independence.

We tell ourselves it’s no big deal. What’s one click? What’s one form? But the permissions pile up. The chains grow heavier. And one day, you wake up and realize you’re free to do exactly what the system allows—and nothing more.

---

The Great Unpermissioning

It doesn’t have to be this way. You don’t need their approval. You don’t need their systems. You don’t need their permission.

The Great Unpermissioning is not a movement—it’s a mindset. It’s the refusal to accept a life mediated by gatekeepers. It’s the quiet rebellion of saying, “No.” It’s the realization that the freedom you seek won’t be granted—it must be reclaimed.

• Stop asking. Permission is their tool. Refusal is your weapon.
• Start building. Embrace tools that decentralize power: Bitcoin, encryption, open-source software, decentralized communication. Build systems they can’t control.
• Stand firm. They’ll tell you it’s dangerous. They’ll call you a radical. But remember: the most dangerous thing you can do is comply.

The path won’t be easy. Freedom never is. But it will be worth it.

---

The New Frontier

The age of permission has turned us into digital serfs, but there’s a new frontier on the horizon. It’s a world where you control your money, your data, your decisions. It’s a world of encryption, anonymity, and sovereignty. It’s a world built not on permission but on principles.

This world won’t be given to you. You have to build it. You have to fight for it. And it starts with one simple act: refusing to comply.

---

A Final Word

They promised us safety, but what they delivered was submission. The age of permission has enslaved us to the mundane, the monitored, and the mediocre. The Great Unpermissioning isn’t about tearing down the old world—it’s about walking away from it.

You don’t need to wait for their approval. You don’t need to ask for their permission. The freedom you’re looking for is already yours. Permission is their power—refusal is yours.

@ 318ebaba:9a262eae

Relays play a crucial role in the Nostr communication protocol, serving as the backbone of its decentralized architecture. Here’s an overview of their functions and significance:

Functions of Nostr Relays

• Data Storage and Broadcasting: Relays act as intermediaries that store and distribute messages between users. When a user sends a message, it is transmitted to one or more relays, which then broadcast that message to other connected clients. This decentralized approach ensures that no single entity controls the flow of information, enhancing censorship resistance[1][2][6].

• Interoperability: Users can connect to multiple relays simultaneously, allowing them to access the same content across different applications. This interoperability means that messages can be shared and retrieved from various clients without being tied to a specific platform, promoting a more flexible user experience[4][11].

• User Control: Anyone can run their own relay, which empowers users to maintain control over their data and interactions. By operating a personal relay, users can ensure that their messages are stored and accessible without relying on third-party services, thus enhancing privacy and security[3][7][11].

• Performance and Reliability: The performance of a Nostr client can be influenced by the relays it connects to. If a relay is slow or unreliable, it can affect the overall user experience. Users are encouraged to choose or add multiple relays to improve message delivery speed and reliability[7][8][11].

Types of Relays

• Public and Private Relays: There are both public and private relays available. Public relays are free to use, while private relays may charge fees. Paid relays often provide better performance and reduced spam, as the cost can deter malicious users from flooding the network with unwanted content[6][7][14].

• Self-Hosted Relays: For those who want maximum control and privacy, setting up a self-hosted relay is an option. This allows users to manage their own data and ensure that their communications are not subject to external censorship or data loss[4][7].

In summary, relays are essential to the Nostr protocol, facilitating decentralized communication by storing, broadcasting, and managing messages across a network of users. They enhance user autonomy, improve performance, and contribute to the overall resilience of the Nostr ecosystem. [1] https://www.voltage.cloud/blog/the-essential-guide-to-nostr-relays [2] https://substack.com/home/post/p-158872714?utm_campaign=post&utm_medium=web [3] https://www.purplerelay.com/how-to-run-a-nostr-relay-a-step-by-step-guide/ [4] https://medium.com/@michael.leigh.stewart/nostr-series-part-3-setting-up-a-relay-6f9ca426e43e [5] https://www.voltage.cloud/blog/understanding-nostr-data-storage-relays-and-decentralization [6] https://www.ccn.com/education/what-is-nostr-and-how-to-start-using-nostr/ [7] https://nostr.how/en/relays [8] https://blog.theya.us/what-is-nostr/ [9] https://www.cointribune.com/en/nostr-pour-les-debutants-tout-ce-que-vous-devez-savoir-sur-le-protocole-2/ [10] https://community.umbrel.com/t/introducing-the-official-nostr-relay-app/11339 [11] https://nostr.com/ [12] https://www.habyb.com/blog/nostr-what-is-this-protocol-and-how-does-it-work/ [13] https://www.reddit.com/r/nostr/comments/15jmhpi/purpose_of_free_vs_paid_relay/ [14] https://nostr.com/relays [15] https://www.reddit.com/r/nostr/comments/115cgcu/whats_the_point_of_adding_more_and_more_relays_do/ [16] https://messari.io/copilot/share/understanding-nostr-f00aa3df-d02c-4381-91f5-9a103b8e25ce

@ c9badfea:610f861a

1. Install Image Toolbox (it's free and open source)
2. Open the app, then go to the Tools tab
3. Select Checksum Tools
4. Navigate to the Compare tab
5. Choose the SHA-256 algorithm
6. Pick the file to verify
7. Enter the expected hash into the Checksum To Compare field
8. A "Match!" message confirms successful verification

@ b8851a06:9b120ba1

Brett Scott’s recent metaphor of Bitcoin as a wrestling gimmick, reliant on hype and dollar-dependence, reduces a groundbreaking monetary innovation to shallow theatrics. Let’s address his key missteps with hard facts.

---

1. Bitcoin Isn’t an Asset in the System—It’s the System

Scott claims Bitcoin competes with stocks, bonds, and gold in a financial "wrestling ring." This misrepresents Bitcoin’s purpose: it’s not an investment vehicle but a decentralized monetary network. Unlike assets, Bitcoin enables permissionless global value transfer, censorship resistance, and self-sovereign wealth storage—capabilities fiat currencies cannot match.

Fact: Bitcoin processes over $8 billion in daily transactions, settling more value annually than PayPal and Venmo combined. It isn’t competing with assets but offering an alternative to the monetary system itself.

---

2. Volatility Is Growth, Not Failure

Scott critiques Bitcoin’s price volatility as evidence of its unsuitability as "money." However, volatility is a natural stage in the adoption of transformative technology. Bitcoin is scaling from niche use to global recognition. Its growing liquidity and adoption already make it more stable than fiat in inflationary economies.

Fact: Bitcoin’s annualized volatility has decreased by 53% since 2013 and continues to stabilize as adoption rises. It’s the best-performing asset of the last decade, with an average annual ROI of 147%—far outpacing stocks, gold, and real estate. As of February 2024, Bitcoin's volatility was lower than roughly 900 stocks in the S and P 1500 and 190 stocks in the S and P 500. It continues to stabilize as adoption rises, making it an increasingly attractive store of value.

---

3. Bitcoin’s Utility Extends Beyond Countertrade

Scott diminishes Bitcoin to a "countertrade token," reliant on its dollar price. This ignores Bitcoin’s primary functions:

• Medium of exchange: Used in remittances, cross-border payments, and for the unbanked in Africa today (e.g., Ghana, Nigeria, Kenya).
• Store of value: A hedge against inflation and failing fiat systems (e.g., Argentina, Lebanon, Turkey).
• Decentralized reserve asset: Held by over 1,500 public and private institutions, including Tesla, MicroStrategy, and nations like El Salvador.

Fact: Lightning Network adoption has grown 1,500% in capacity since 2021, enabling microtransactions and reducing fees—making Bitcoin increasingly viable for everyday use. As of December 2024, Sub-Saharan Africa accounts for 2.7% of global cryptocurrency transaction volume, with Nigeria ranking second worldwide in crypto adoption. This demonstrates Bitcoin's real-world utility beyond mere speculation.

---

4. Bitcoin Isn’t Controlled by the Dollar

Scott suggests Bitcoin strengthens the dollar system rather than challenging it. In truth, Bitcoin exists outside the control of any nation-state. It offers people in authoritarian regimes and hyperinflationary economies a lifeline when their local currencies fail.

Fact: Over 70% of Bitcoin transactions occur outside the U.S., with adoption highest in countries like Nigeria, India, Venezuela, China, the USA and Ukraine—where the dollar isn’t dominant but government overreach and fiat collapse are. This global distribution shows Bitcoin's independence from dollar dominance.

---

5. Hype vs. Adoption

Scott mocks Bitcoin’s evangelists but fails to acknowledge its real-world traction. Bitcoin adoption isn’t driven by hype but by trustless, verifiable technology solving real-world problems. People don’t buy Bitcoin for "kayfabe"; they buy it for what it does.

Fact: Bitcoin wallets reached 500 million globally in 2023. El Salvador’s Chivo wallet onboarded 4 million users (60% of the population) within a year—far from a gimmick in action. As of December 2024, El Salvador's Bitcoin portfolio has crossed $632 million in value, with an unrealized profit of $362 million, demonstrating tangible benefits beyond hype.

---

6. The Dollar’s Coercive Monopoly vs. Bitcoin’s Freedom

Scott defends fiat money as more than "just numbers," backed by state power. He’s correct: fiat relies on coercion, legal mandates, and inflationary extraction. Bitcoin, by contrast, derives value from transparent scarcity (capped at 21 million coins) and decentralized consensus, not military enforcement or political whims.

Fact: Bitcoin’s inflation rate is just 1.8%—lower than gold or the U.S. dollar—and will approach 0% by 2140. No fiat currency can match this predictability. As of December 2024, Bitcoin processes an average of 441,944 transactions per day, showcasing its growing role as a global, permissionless monetary system free from centralized control.

---

Conclusion: The Revolution Is Real

Scott’s "wrestling gimmick" analogy trivializes Bitcoin’s purpose and progress. Bitcoin isn’t just a speculative asset—it’s the first truly decentralized, apolitical form of money. Whether as a hedge against inflation, a tool for financial inclusion, or a global settlement network, Bitcoin is transforming how we think about money.

Dismiss it as a gimmick at your peril. The world doesn’t need another asset—it needs Bitcoin.

"If you don't believe me or don't get it, I don't have time to try to convince you, sorry." Once Satoshi said.

There is no second best.

@ 318ebaba:9a262eae

Nostr, which stands for "Notes and Other Stuff Transmitted by Relays," is a decentralized communication protocol designed to facilitate the exchange of messages without relying on centralized servers. This innovative framework allows users to create, broadcast, and receive messages freely, emphasizing user empowerment and censorship resistance.

Key Features of Nostr

• Decentralization: Unlike traditional social media platforms, Nostr operates on a network of relays, which are servers that anyone can run. This structure eliminates the control that a single entity can exert over the platform, thereby reducing the risk of censorship and enhancing user privacy[1][4][5].

• Open Protocol: Nostr is not an application itself but a protocol that developers can use to build various applications. This openness allows for a wide range of services, from social media to messaging, all built on the same underlying technology. Users can access multiple applications using a single public/private key pair, making it easier to manage their online identities[2][3][4].

• Censorship Resistance: One of the primary motivations behind Nostr's creation is to provide a platform where users can communicate without fear of censorship. This is particularly appealing to those disillusioned with traditional social media platforms that often impose restrictions on content[5][10].

• User Control: Nostr empowers users by allowing them to control their data and interactions. Users can choose which relays to connect to and can run their own relays, ensuring that they are not dependent on any single service provider[4][5][7].

• Cryptographic Security: The protocol employs public-key cryptography to secure messages and verify identities, similar to how Bitcoin operates. This ensures that messages are authentic and have not been tampered with during transmission[5][10].

Applications and Community

Nostr has gained traction among various communities, particularly within the cryptocurrency space, where figures like Jack Dorsey and Edward Snowden have expressed support for its potential to reshape online communication. The protocol's design allows for a variety of applications, including social media platforms, chat services, and content sharing tools, all of which can interoperate seamlessly[2][3][5].

In summary, Nostr represents a significant shift in how digital communication can be structured, prioritizing decentralization, user autonomy, and resistance to censorship, making it a compelling alternative to conventional social media platforms. [1] https://threenine.blog/posts/what-is-nostr [2] https://www.forbes.com/sites/digital-assets/2023/04/11/how-to-get-started-with-nostr/ [3] https://www.forbes.com/sites/digital-assets/2024/07/17/your-guide-to-nostr-the-decentralized-network-for-everything/ [4] https://www.ledger.com/academy/glossary/nostr [5] https://river.com/learn/what-is-nostr/ [6] https://www.cointribune.com/en/comment-utiliser-nostr-guide-pour-debutants-2/ [7] https://www.ccn.com/education/what-is-nostr-and-how-to-start-using-nostr/ [8] https://nostr.com/ [9] https://mylessnider.com/articles/why-im-excited-about-nostr [10] https://en.wikipedia.org/wiki/Nostr [11] https://nostr.how/en/what-is-nostr [12] https://nostr.org/ [13] https://medium.com/@colaru/an-introduction-to-nostr-protocol-dbc774ac797c [14] https://www.linkedin.com/pulse/what-nostr-manfred-van-doorn-nf9ce [15] https://www.cointribune.com/en/nostr-pour-les-debutants-tout-ce-que-vous-devez-savoir-sur-le-protocole-2/ [16] https://www.reddit.com/r/Bitcoin/comments/17j5glg/do_people_in_this_sub_know_about_nostr/ [17] https://www.voltage.cloud/blog/the-essential-guide-to-nostr-relays [18] https://www.reddit.com/r/nostr/comments/1i6t4g7/explain_how_nostr_works_like_im_a_5_year_old/ [19] https://github.com/nostr-protocol/nostr

@ f5369849:f34119a0

Hackathon Summary

The Stellar Build Better Hackathon concluded successfully, attracting 220 registered developers and approving 84 projects. This event aimed to utilize Stellar's smart contracts for practical applications, emphasizing community collaboration and technological progress. Participants competed for a total prize pool of $25,000 in USDC, distributed among three categories: Better Finance, Better Creativity, and Better Access.

Developers explored areas such as DeFi accessibility tools, cross-border payment solutions, creator economy platforms, and identity solutions. The hackathon facilitated networking opportunities with global developers and exposure to leading crypto companies. Additionally, technical workshops and live demo sessions were provided to support participants.

In terms of achievements, the first-place prize of 12,000 USDC was awarded to a project enhancing financial accessibility. Second and third place winners received prizes valued at 8,000 and 5,000 USDC, respectively, acknowledging innovations in creative tools and accessibility solutions. Through these awards, the event underscored Stellar’s role in fostering practical innovations that expand smart contract applications within its ecosystem.

Hackathon Winners

Build Better Prizes

The prizes recognized the best projects across categories.

First Place

PayZoll_Stellar - PayZoll integrates AI and blockchain within the Stellar ecosystem to offer secure, automated, and transparent global payroll services, enhancing payroll management efficiency and reliability.

Second Place

StellarFinance - This platform facilitates connections between users and financial advisors on the Stellar blockchain, providing secure and transparent financial services focused on integrity and user engagement.

Third Place

Soroban to MCP Server in seconds + Policy Signers Playground - This solution transforms Stellar Soroban smart contracts into MCP servers for natural language interactions, enabling AI agent execution and enhancing smart contract functionality.

View all projects from the hackathon at DoraHacks.

Organization

About the Organizer: Stellar Development Foundation

The Stellar Development Foundation strives to promote the growth and development of the Stellar network, a blockchain platform aimed at facilitating efficient cross-border transactions. With a focus on decentralized finance (DeFi), the foundation implements projects that advance financial inclusion worldwide. By partnering with a broad network, the organization promotes scalable blockchain solutions, ensuring accessibility and reliability in financial services. Its mission is to provide equitable access to the global economy through innovative, open-source technology.

@ b99efe77:f3de3616

asfadfadsf draft

afasdfasdfsadf

petrinet ;startDay () -> working ;stopDay working -> () ;startPause working -> paused ;endPause paused -> working ;goSmoke working -> smoking ;endSmoke smoking -> working ;startEating working -> eating ;stopEating eating -> working ;startCall working -> onCall ;endCall onCall -> working ;startMeeting working -> inMeetinga ;endMeeting inMeeting -> working ;logTask working -> working

@ c9badfea:610f861a

1. Install PocketPal (it's free and open source)
2. Launch the app, open the menu, and navigate to Models
3. Download one or more models (e.g. Phi, Llama, Qwen)
4. Once downloaded, tap Load to start chatting

ℹ️ Experiment with different models and their quantizations (Q4, Q6, Q8, etc.) to find the most suitable one

@ 06b7819d:d1d8327c

The Peano axioms are a set of rules that define the natural numbers (like 0, 1, 2, 3, and so on) in a logical way. Here’s a simplified explanation: 1. There is a first number: There is a number called zero, and it is the starting point for all natural numbers. 2. Each number has a next number: Every number has a unique “successor,” or the number that comes after it (like 1 comes after 0, 2 comes after 1, etc.). 3. Zero is special: Zero is not the “next” number of any other number. This means the sequence of natural numbers doesn’t loop back to zero. 4. No two numbers are the same if they have different successors: If two numbers have the same “next” number, then they must actually be the same number. 5. Patterns hold for all numbers: If something is true for zero, and it stays true when moving from one number to the next, then it must be true for all numbers.

These principles lay the groundwork for understanding and working with the natural numbers systematically.

@ 57d1a264:69f1fee1

Finale: once the industry-standard of music notation software, now a cautionary tale. In this video, I explore how it slowly lost its crown through decades of missed opportunities - eventually leading to creative collapse due to various bureaucratic intrigues, unforeseen technological changes and some of the jankiest UI/UX you've ever seen.

https://www.youtube.com/watch?v=Yqaon6YHzaU

originally posted at https://stacker.news/items/976219

@ 06b7819d:d1d8327c

Power as the Reduction of Possibilities: Niklas Luhmann’s Perspective

Niklas Luhmann, a leading figure in systems theory, offers a unique conceptualization of power that diverges from traditional notions of domination or coercion. Rather than viewing power as a forceful imposition of will, Luhmann frames it as a mechanism for reducing possibilities within a given social system. For Luhmann, power is less about direct coercion and more about structuring decision-making processes by limiting the range of available options.

In his systems-theoretical approach, Luhmann argues that power operates as a communication medium, enabling complex social systems to function by simplifying the overwhelming array of potential actions. In any decision-making context, there are countless possibilities, and not all can be pursued. Power serves as a tool to focus attention, filter alternatives, and channel behavior toward specific actions while excluding others. This reduction of options creates a manageable environment for coordinated action, which is essential for the stability of a system.

Importantly, this process does not inherently involve force or threats. Instead, power works through expectations, norms, and structures that guide behavior. For example, in an organizational setting, the hierarchy of authority determines which decisions are permissible, thereby shaping the actions of individuals without overt coercion. The employees’ actions are not forced; rather, they are conditioned by the organizational framework, which narrows their choices.

Luhmann’s idea redefines power as a productive force in social systems. By limiting possibilities, power reduces uncertainty, making collaboration and collective action possible. It ensures that systems can function efficiently despite their inherent complexity. This perspective shifts the emphasis from conflict to coordination, offering a more nuanced understanding of how power operates in modern societies.

In sum, Niklas Luhmann’s theory of power as the reduction of possibilities highlights its integrative role in enabling social systems to navigate complexity. It challenges conventional views of power as coercion, emphasizing its capacity to organize and stabilize interactions through the selective limitation of actions.

@ 57d1a264:69f1fee1

---

For generations before generative text, writers have used the em dash to hop between thoughts, emotions, and ideas. Dickens shaped his morality tales with it, Woolf’s stream-of-consciousness flowed through it, Kerouac let it drive his jazz-like prose. Today, Sally Rooney threads it through her quiet truths of the heart.

---

---

But this beloved punctuation mark has become a casualty of the algorithmic age. The em dash has been so widely adopted by AI-generated text that even when used by human hands, it begs the question: was this actually written or apathetically prompted?

---

---

The battle for the soul of writing is in full swing. And the human fightback starts here. With a new punctuation mark that serves as a symbol of real pondering, genuine daydreaming, and true editorial wordsmithery. Inspired by Descartes’ belief that thinking makes us human, the am dash is a small but powerful testament that the words you’ve painstakingly and poetically pulled together are unequivocally, certifiably, and delightfully your own.

---

---

Let's reclain writig from AI—oneam dash at time.

Download the fonts:

— Aereal https://bit.ly/3EO6fo8 — Times New Human https://bit.ly/4jQTcRS

---

---

Learn more about the am dash

https://www.theamdash.com

---

originally posted at https://stacker.news/items/976218

@ 06b7819d:d1d8327c

The History of Bananas as an Exportable Fruit and the Rise of Banana Republics

Bananas became a significant export in the late 19th century, fueled by advancements in transportation and refrigeration that allowed the fruit to travel long distances without spoilage. Originally native to Southeast Asia, bananas were introduced to the Americas by European colonists. By the late 1800s, companies like the United Fruit Company (later Chiquita) and Standard Fruit Company (now Dole) began cultivating bananas on a large scale in Central America and the Caribbean.

These corporations capitalized on the fruit’s appeal—bananas were cheap, nutritious, and easy to transport. The fruit quickly became a staple in Western markets, especially in the United States. However, the rapid expansion of banana exports came at a significant political and social cost to the countries where the fruit was grown.

To maintain control over banana production and maximize profits, these companies required vast amounts of arable land, labor, and favorable trade conditions. This often led them to form close relationships with local governments, many of which were authoritarian and corrupt. The companies influenced policies to secure land concessions, suppress labor rights, and maintain low taxes.

The term “banana republic” was coined by writer O. Henry in 1904 to describe countries—particularly in Central America—that became politically unstable due to their economic dependence on a single export crop, often controlled by foreign corporations.

The U.S. government frequently supported these regimes as part of its broader strategy during the Cold War to counter communist influence in the region. Washington feared that labor movements and demands for land reform, often supported by the peasantry and indigenous groups, could lead to the rise of socialist or communist governments. Consequently, the U.S. backed coups, such as the 1954 overthrow of Guatemala’s democratically elected President Jacobo Árbenz, who had threatened United Fruit’s interests by redistributing unused land.

These interventions created a legacy of exploitation, environmental degradation, and political instability in many banana-exporting countries. While bananas remain a global dietary staple, their history underscores the complex interplay of economics, politics, and imperialism.

@ 57d1a264:69f1fee1

Consider the following two charts from A History of Clojure which detail the introduction and retention of new code by release for both Clojure and for Scala.

While this doesn't necessarily translate to library stability, it's reasonable to assume that the attitude of the Clojure maintainers will seep into the community. And that assumption is true.

Consider a typical Javascript program. What is it comprised of? Objects, objects, and more objects. Members of those objects must be either introspected or divined. Worse, it's normal to monkeypatch those objects, so the object members may (or may not) change over time.

Now, consider a typical Clojure program. What is it comprised of? Namespaces. Those namespaces contain functions and data. Functions may be dynamically generated (via macros), but it is extremely rare to "monkeypatch" a namespace. If you want to know what functions are available in a namespace, you can simply read the source file.

Continue reading https://potetm.com/devtalk/stability-by-design.html

originally posted at https://stacker.news/items/976215

@ 088436cd:9d2646cc

The arrival of the coronavirus brought not only illness and death but also fear and panic. In such an environment of uncertainty, people have naturally stocked up on necessities, not knowing when things will return to normal.

Retail shelves have been cleared out, and even online suppliers like Amazon and Walmart are out of stock for some items. Independent sellers on these e-commerce platforms have had to fill the gap. With the huge increase in demand, they have found that their inventory has skyrocketed in value.

Many in need of these items (e.g. toilet paper, hand sanitizer and masks) balk at the new prices. They feel they are being taken advantage of in a time of need and call for intervention by the government to lower prices. The government has heeded that call, labeling the independent sellers as "price gougers" and threatening sanctions if they don't lower their prices. Amazon has suspended seller accounts and law enforcement at all levels have threatened to prosecute. Prices have dropped as a result and at first glance this seems like a victory for fair play. But, we will have to dig deeper to understand the unseen consequences of this intervention.

We must look at the economics of the situation, how supply and demand result in a price and how that price acts as a signal that goes out to everyone, informing them of underlying conditions in the economy and helping coordinate their actions.

It all started with a rise in demand. Given a fixed supply (e.g., the limited stock on shelves and in warehouses), an increase in demand inevitably leads to higher prices. Most people are familiar with this phenomenon, such as paying more for airline tickets during holidays or surge pricing for rides.

Higher prices discourage less critical uses of scarce resources. For example, you might not pay $1,000 for a plane ticket to visit your aunt if you can get one for $100 the following week, but someone else might pay that price to visit a dying relative. They value that plane seat more than you.

*** During the crisis, demand surged and their shelves emptied even though

However, retail outlets have not raised prices. They have kept them low, so the low-value uses of things like toilet paper, masks and hand sanitizer has continued. Often, this "use" just takes the form of hoarding. At everyday low prices, it makes sense to buy hundreds of rolls and bottles. You know you will use them eventually, so why not stock up? And, with all those extra supplies in the closet and basement, you don't need to change your behavior much. You don't have to ration your use.

At the low prices, these scarce resources got bought up faster and faster until there was simply none left. The reality of the situation became painfully clear to those who didn't panic and got to the store late: You have no toilet paper and you're not going to any time soon.

However, if prices had been allowed to rise, a number of effects would have taken place that would have coordinated the behavior of everyone so that valuable resources would not have been wasted or hoarded, and everyone could have had access to what they needed.

On the demand side, if prices had been allowed to rise, people would have begun to self-ration. You might leave those extra plies on the roll next time if you know they will cost ten times as much to replace. Or, you might choose to clean up a spill with a rag rather than disposable tissue. Most importantly, you won't hoard as much. That 50th bottle of hand sanitizer might just not be worth it at the new, high price. You'll leave it on the shelf for someone else who may have none.

On the supply side, higher prices would have incentivized people to offer up more of their stockpiles for sale. If you have a pallet full of toilet paper in your basement and all of the sudden they are worth $15 per roll, you might just list a few online. But, if it is illegal to do so, you probably won't.

Imagine you run a business installing insulation and have a few thousand respirator masks on hand for your employees. During a pandemic, it is much more important that people breathe filtered air than that insulation get installed, and that fact is reflected in higher prices. You will sell your extra masks at the higher price rather than store them for future insulation jobs, and the scarce resource will be put to its most important use.

Producers of hand sanitizer would go into overdrive if prices were allowed to rise. They would pay their employees overtime, hire new ones, and pay a premium for their supplies, making sure their raw materials don't go to less important uses.

These kinds of coordinated actions all across the economy would be impossible without real prices to guide them. How do you know if it makes sense to spend an extra $10k bringing a thousand masks to market unless you know you can get more than $10 per mask? If the price is kept artificially low, you simply can't do it. The money just isn't there.

These are the immediate effects of a price change, but incredibly, price changes also coordinate people's actions across space and time.

Across space, there are different supply and demand conditions in different places, and thus prices are not uniform. We know some places are real "hot spots" for the virus, while others are mostly unaffected. High demand in the hot spots leads to higher prices there, which attracts more of the resource to those areas. Boxes and boxes of essential items would pour in where they are needed most from where they are needed least, but only if prices were allowed to adjust freely.

This would be accomplished by individuals and businesses buying low in the unaffected areas, selling high in the hot spots and subtracting their labor and transportation costs from the difference. Producers of new supply would know exactly where it is most needed and ship to the high-demand, high-price areas first. The effect of these actions is to increase prices in the low demand areas and reduce them in the high demand areas. People in the low demand areas will start to self-ration more, reflecting the reality of their neighbors, and people in the hotspots will get some relief.

However, by artificially suppressing prices in the hot spot, people there will simply buy up the available supply and run out, and it will be cost prohibitive to bring in new supply from low-demand areas.

Prices coordinate economic actions across time as well. Just as entrepreneurs and businesses can profit by transporting scarce necessities from low-demand to high-demand areas, they can also profit by buying in low-demand times and storing their merchandise for when it is needed most.

Just as allowing prices to freely adjust in one area relative to another will send all the right signals for the optimal use of a scarce resource, allowing prices to freely adjust over time will do the same.

When an entrepreneur buys up resources during low-demand times in anticipation of a crisis, she restricts supply ahead of the crisis, which leads to a price increase. She effectively bids up the price. The change in price affects consumers and producers in all the ways mentioned above. Consumers self-ration more, and producers bring more of the resource to market.

Our entrepreneur has done a truly incredible thing. She has predicted the future, and by so doing has caused every individual in the economy to prepare for a shortage they don't even know is coming! And, by discouraging consumption and encouraging production ahead of time, she blunts the impact the crisis will have. There will be more of the resource to go around when it is needed most.

On top of this, our entrepreneur still has her stockpile she saved back when everyone else was blithely using it up. She can now further mitigate the damage of the crisis by selling her stock during the worst of it, when people are most desperate for relief. She will know when this is because the price will tell her, but only if it is allowed to adjust freely. When the price is at its highest is when people need the resource the most, and those willing to pay will not waste it or hoard it. They will put it to its highest valued use.

The economy is like a big bus we are all riding in, going down a road with many twists and turns. Just as it is difficult to see into the future, it is difficult to see out the bus windows at the road ahead.

On the dashboard, we don't have a speedometer or fuel gauge. Instead we have all the prices for everything in the economy. Prices are what tell us the condition of the bus and the road. They tell us everything. Without them, we are blind.

Good times are a smooth road. Consumer prices and interest rates are low, investment returns are steady. We hit the gas and go fast. But, the road is not always straight and smooth. Sometimes there are sharp turns and rough patches. Successful entrepreneurs are the ones who can see what is coming better than everyone else. They are our navigators.

When they buy up scarce resources ahead of a crisis, they are hitting the brakes and slowing us down. When they divert resources from one area to another, they are steering us onto a smoother path. By their actions in the market, they adjust the prices on our dashboard to reflect the conditions of the road ahead, so we can prepare for, navigate and get through the inevitable difficulties we will face.

Interfering with the dashboard by imposing price floors or price caps doesn't change the conditions of the road (the number of toilet paper rolls in existence hasn't changed). All it does is distort our perception of those conditions. We think the road is still smooth--our heavy foot stomping the gas--as we crash onto a rocky dirt road at 80 miles per hour (empty shelves at the store for weeks on end).

Supply, demand and prices are laws of nature. All of this is just how things work. It isn't right or wrong in a moral sense. Price caps lead to waste, shortages and hoarding as surely as water flows downhill. The opposite--allowing prices to adjust freely--leads to conservation of scarce resources and their being put to their highest valued use. And yes, it leads to profits for the entrepreneurs who were able to correctly predict future conditions, and losses for those who weren't.

Is it fair that they should collect these profits? On the one hand, anyone could have stocked up on toilet paper, hand sanitizer and face masks at any time before the crisis, so we all had a fair chance to get the supplies cheaply. On the other hand, it just feels wrong that some should profit so much at a time when there is so much need.

Our instinct in the moment is to see the entrepreneur as a villain, greedy "price gouger". But we don't see the long chain of economic consequences the led to the situation we feel is unfair.

If it weren't for anti-price-gouging laws, the major retailers would have raised their prices long before the crisis became acute. When they saw demand outstrip supply, they would have raised prices, not by 100 fold, but gradually and long before anyone knew how serious things would have become. Late comers would have had to pay more, but at least there would be something left on the shelf.

As an entrepreneur, why take risks trying to anticipate the future if you can't reap the reward when you are right? Instead of letting instead of letting entrepreneurs--our navigators--guide us, we are punishing and vilifying them, trying to force prices to reflect a reality that simply doesn't exist.

In a crisis, more than any other time, prices must be allowed to fluctuate. To do otherwise is to blind ourselves at a time when danger and uncertainty abound. It is economic suicide.

In a crisis, there is great need, and the way to meet that need is not by pretending it's not there, by forcing prices to reflect a world where there isn't need. They way to meet the need is the same it has always been, through charity.

If the people in government want to help, the best way for the to do so is to be charitable and reduce their taxes and fees as much as possible, ideally to zero in a time of crisis. Amazon, for example, could instantly reduce the price of all crisis related necessities by 20% if they waived their fee. This would allow for more uses by more people of these scarce supplies as hoarders release their stockpiles on to the market, knowing they can get 20% more for their stock. Governments could reduce or eliminate their tax burden on high-demand, crisis-related items and all the factors that go into their production, with the same effect: a reduction in prices and expansion of supply. All of us, including the successful entrepreneurs and the wealthy for whom high prices are not a great burden, could donate to relief efforts.

These ideas are not new or untested. This is core micro economics. It has been taught for hundreds of years in universities the world over. The fact that every crisis that comes along stirs up ire against entrepreneurs indicates not that the economics is wrong, but that we have a strong visceral reaction against what we perceive to be unfairness. This is as it should be. Unfairness is wrong and the anger it stirs in us should compel us to right the wrong. Our anger itself isn't wrong, it's just misplaced.

Entrepreneurs didn't cause the prices to rise. Our reaction to a virus did that. We saw a serious threat and an uncertain future and followed our natural impulse to hoard. Because prices at major retail suppliers didn't rise, that impulse ran rampant and we cleared the shelves until there was nothing left. We ran the bus right off the road and them blamed the entrepreneurs for showing us the reality of our situation, for shaking us out of the fantasy of low prices.

All of this is not to say that entrepreneurs are high-minded public servants. They are just doing their job. Staking your money on an uncertain future is a risky business. There are big risks and big rewards. Most entrepreneurs just scrape by or lose their capital in failed ventures.

However, the ones that get it right must be allowed to keep their profits, or else no one will try and we'll all be driving blind. We need our navigators. It doesn't even matter if they know all the positive effects they are having on the rest of us and the economy as a whole. So long as they are buying low and selling high--so long as they are doing their job--they will be guiding the rest of us through the good times and the bad, down the open road and through the rough spots.

@ 06b7819d:d1d8327c

Benjamin Franklin and His Fondness for Madeira Wine

Benjamin Franklin, one of America’s most celebrated founding fathers, was not only a statesman, scientist, and writer but also a man of refined taste. Among his many indulgences, Franklin was particularly fond of Madeira wine, a fortified wine from the Portuguese Madeira Islands. His love for this drink was well-documented and reflects both his personal preferences and the broader cultural trends of 18th-century America.

The Allure of Madeira Wine

Madeira wine was highly prized in the 18th century due to its unique production process and exceptional durability. Its rich, fortified nature made it well-suited for long sea voyages, as it could withstand temperature fluctuations and aging in transit. This durability made Madeira a popular choice in the American colonies, where European wines often spoiled before arrival.

Franklin, who was known for his appreciation of fine things, embraced Madeira as a beverage of choice. Its complex flavors and storied reputation resonated with his intellectual and social pursuits. The wine was often served at dinners and social gatherings, where Franklin and his contemporaries debated ideas and shaped the future of the nation.

Franklin’s Personal Connection to Madeira

In Franklin’s writings and correspondence, Madeira is mentioned on several occasions, reflecting its prominence in his life. He referred to the wine not only as a personal pleasure but also as a symbol of hospitality and refinement. As a diplomat in France and England, Franklin often carried Madeira to share with his hosts, using it as a means of forging connections and showcasing the tastes of the American colonies.

One notable instance of Franklin’s affinity for Madeira occurred during his time in Philadelphia. He reportedly had cases of the wine shipped directly to his home, ensuring he would never be without his favorite drink. Madeira also featured prominently in many toasts and celebrations, becoming a hallmark of Franklin’s gatherings.

The Role of Madeira in Colonial America

Franklin’s fondness for Madeira reflects its broader significance in colonial America. The wine was not only a favorite of the elite but also a symbol of resistance to British taxation. When the British imposed heavy duties on imported goods, including wine, Madeira became a patriotic choice for many colonists. Its direct trade routes with the Madeira Islands circumvented British intermediaries, allowing Americans to assert their economic independence.

A Legacy of Taste

Franklin’s appreciation for Madeira wine endures as a charming detail of his multifaceted life. It offers a glimpse into the personal habits of one of America’s most influential figures and highlights the cultural exchanges that shaped colonial society. Today, Franklin’s love of Madeira serves as a reminder of the historical connections between wine, politics, and personal expression in the 18th century.

In honoring Franklin’s legacy, one might raise a glass of Madeira to toast not only his contributions to American independence but also his enduring influence on the art of living well.

@ 84da1875:0088fe3c

O mundo do entretenimento digital está em constante evolução, e o 90PMBET surge como uma das plataformas mais promissoras para quem busca diversão, praticidade e uma experiência envolvente. Com uma interface moderna, ampla variedade de jogos e suporte eficiente, o 90PMBET conquista cada vez mais jogadores brasileiros que desejam explorar novas formas de lazer online com total segurança e acessibilidade.

Conheça a Plataforma 90PMBET A proposta do 90PMBET é simples e objetiva: oferecer um ambiente online completo, onde o usuário pode aproveitar diferentes modalidades de jogos com total comodidade. A plataforma é totalmente otimizada para dispositivos móveis e computadores, garantindo uma navegação fluida e intuitiva em qualquer tela. Desde o primeiro acesso, é possível perceber o cuidado com a experiência do usuário — os menus são bem organizados, as categorias são de fácil acesso e todas as funções principais estão a poucos cliques de distância.

Outro ponto que merece destaque é a segurança. O 90pmbetadota tecnologias avançadas de proteção de dados, como criptografia SSL e autenticação de conta, garantindo que os dados dos usuários estejam protegidos o tempo todo. Além disso, os métodos de pagamento são diversificados e incluem as opções mais populares entre os brasileiros, como PIX, transferência bancária e carteiras digitais.

Variedade de Jogos para Todos os Gostos Um dos maiores atrativos do 90PMBET é a impressionante seleção de jogos disponíveis. A plataforma reúne títulos desenvolvidos pelos principais estúdios do mercado, o que garante qualidade gráfica, boa jogabilidade e mecânicas justas.

Entre os jogos mais populares, destacam-se:

Slots modernos com temáticas variadas, efeitos visuais marcantes e rodadas bônus;

Jogos ao vivo que permitem uma experiência imersiva e interativa com apresentadores reais;

Jogos de mesa tradicionais, como roleta, blackjack e pôquer, em versões otimizadas para o ambiente digital;

Apostas esportivas, com cobertura de eventos nacionais e internacionais em diferentes modalidades, incluindo futebol, basquete e eSports.

Independentemente do estilo de jogo preferido, o 90PMBET oferece opções para todos os perfis de jogadores — desde os mais estratégicos até os que preferem partidas rápidas e dinâmicas.

Uma Experiência do Jogador Realmente Diferenciada A experiência do jogador no 90PMBET é marcada por praticidade, suporte de qualidade e constantes oportunidades de bônus e promoções. A equipe de atendimento está disponível 24 horas por dia, 7 dias por semana, por meio de chat ao vivo e e-mail, sempre pronta para solucionar dúvidas e oferecer suporte técnico.

Outro diferencial é o sistema de recompensas e promoções diárias, que valoriza tanto os novos jogadores quanto os usuários mais antigos. Bônus de boas-vindas, giros gratuitos, cashback e torneios semanais são apenas alguns exemplos das vantagens oferecidas pela plataforma.

Além disso, o 90PMBET promove um ambiente responsável, com ferramentas de controle de tempo de jogo e limites de depósito, ajudando os usuários a manterem uma relação saudável com o entretenimento online.

Conclusão O 90PMBET é mais do que apenas uma plataforma de jogos — é um verdadeiro centro de entretenimento digital pensado para o público brasileiro. Com sua estrutura moderna, ampla variedade de opções, promoções atrativas e foco total na experiência do usuário, o 90PMBET se firma como uma das melhores escolhas para quem busca diversão e emoção no mundo virtual.

Se você ainda não conhece, essa é a hora perfeita para explorar o universo de possibilidades que o 90PMBET tem a oferecer. A diversão está a apenas um clique de distância!

@ 06b7819d:d1d8327c

The Weaponization of Technology: A Prelude to Adoption

Throughout history, new technologies have often been weaponized before becoming widely adopted for civilian use. This pattern, deeply intertwined with human priorities for power, survival, and dominance, sheds light on how societies interact with technological innovation.

The Weaponization Imperative

When a groundbreaking technology emerges, its potential to confer an advantage—military, economic, or ideological—tends to attract attention from those in power. Governments and militaries, seeking to outpace rivals, often invest heavily in adapting new tools for conflict or defense. Weaponization provides a context where innovation thrives under high-stakes conditions. Technologies like radar, nuclear energy, and the internet, initially conceived or expanded within the framework of military priorities, exemplify this trend.

Historical Examples

1.  Gunpowder: Invented in 9th-century China, gunpowder was first used for military purposes before transitioning into civilian life, influencing mining, construction, and entertainment through fireworks.

1. The Internet: Initially developed as ARPANET during the Cold War to ensure communication in the event of a nuclear attack, the internet’s infrastructure later supported the global digital revolution, reshaping commerce, education, and social interaction.

2. Drones: Unmanned aerial vehicles began as tools of surveillance and warfare but have since been adopted for everything from package delivery to agricultural monitoring.

Weaponization often spurs rapid technological development. War environments demand urgency and innovation, fast-tracking research and turning prototypes into functional tools. This phase of militarization ensures that the technology is robust, scalable, and often cost-effective, setting the stage for broader adoption.

Adoption and Civilian Integration

Once a technology’s military dominance is established, its applications often spill into civilian life. These transitions occur when:

•   The technology becomes affordable and accessible.
•   Governments or corporations recognize its commercial potential.
•   Public awareness and trust grow, mitigating fears tied to its military origins.

For example, GPS was first a military navigation system but is now indispensable for personal devices, logistics, and autonomous vehicles.

Cultural Implications

The process of weaponization shapes public perception of technology. Media narratives, often dominated by stories of power and conflict, influence how societies view emerging tools. When technologies are initially seen through the lens of violence or control, their subsequent integration into daily life can carry residual concerns, from privacy to ethical implications.

Conclusion

The weaponization of technology is not an aberration but a recurring feature of technological progress. By understanding this pattern, societies can critically assess how technologies evolve from tools of conflict to instruments of everyday life, ensuring that ethical considerations and equitable access are not lost in the rush to innovate. As Marshall McLuhan might suggest, the medium through which a technology is introduced deeply influences the message it ultimately conveys to the world.

@ 84da1875:0088fe3c

No cenário atual do entretenimento digital, a plataforma CC999 vem se destacando como uma das mais inovadoras e completas opções para quem busca emoção, segurança e variedade em um só lugar. Com uma proposta moderna e acessível, o site oferece uma experiência diferenciada, reunindo jogos envolventes, atendimento de qualidade e uma navegação simples e rápida, ideal tanto para iniciantes quanto para jogadores mais experientes.

Conheça a Plataforma CC999 Desde o primeiro acesso, é fácil perceber que a CC999 foi desenvolvida com foco no usuário. Seu layout é intuitivo, com menus organizados e compatibilidade total com dispositivos móveis, permitindo que você aproveite tudo o que a plataforma oferece diretamente do seu celular, tablet ou computador.

Além disso, o processo de cadastro é rápido e descomplicado. Em poucos minutos, você já pode criar sua conta e começar a explorar os recursos disponíveis. Outro diferencial é o compromisso com a segurança dos dados, utilizando criptografia de ponta e sistemas confiáveis de autenticação para garantir a tranquilidade de todos os usuários.

Jogos para Todos os Gostos A variedade de jogos disponíveis no CC999 é um dos grandes atrativos da plataforma. Ela conta com uma seleção que vai desde jogos clássicos e tradicionais até opções modernas com gráficos impressionantes e mecânicas envolventes. Alguns dos destaques incluem:

Roleta Virtual: Ideal para quem gosta de adrenalina e sorte, com várias versões disponíveis.

Slots Online: Máquinas de giro com temas variados, efeitos visuais marcantes e grandes chances de ganho.

Cartas e Estratégia: Jogos como pôquer e blackjack oferecem experiências desafiadoras para quem curte usar o raciocínio lógico.

Títulos Ao Vivo: Com interação em tempo real, esses jogos garantem uma imersão total e realista, aproximando o jogador da atmosfera presencial.

A CC999 trabalha com provedores renomados, garantindo qualidade, fluidez e jogabilidade de alto nível em todos os títulos. Isso significa que, além da diversão, o jogador tem acesso a conteúdos justos e auditados.

Experiência do Jogador: Conectividade e Recompensas A experiência dos usuários na plataforma é constantemente aprimorada com base em feedbacks e atualizações tecnológicas. O atendimento ao cliente está disponível 24 horas por dia, todos os dias da semana, pronto para resolver qualquer dúvida ou problema com agilidade e cordialidade.

Outro ponto que merece destaque são as promoções e bônus oferecidos pela CC999. Desde o primeiro depósito até campanhas sazonais, os jogadores têm acesso a recompensas atrativas, o que torna a jornada ainda mais interessante. O sistema de fidelidade também premia a constância dos usuários, oferecendo vantagens exclusivas para membros frequentes.

Conclusão A CC999 chega como uma excelente alternativa para quem busca entretenimento online de qualidade. Com uma interface moderna, jogos variados, suporte eficiente e promoções constantes, a plataforma conquista pela seriedade e compromisso com a diversão do usuário. Seja você um veterano ou alguém começando agora nesse universo, o CC999 tem tudo o que você precisa para se divertir com segurança e emoção.

@ 1c19eb1a:e22fb0bc

If you haven't noticed already, #Nostr is a little different from what most people are used to. One of the ways this is felt most acutely is with media hosting. Users are accustomed to uploading their images and videos directly through the app they are posting from. Many Nostr apps provide that same experience nowadays, but it wasn't always the case.

Just a couple years ago, users had to find somewhere to host their media separately, and then copy and paste the URL into their note whenever they wanted to share their cat pictures. One of the first, if not the first, media hosting services specifically intended for Nostr was nostr:npub1nxy4qpqnld6kmpphjykvx2lqwvxmuxluddwjamm4nc29ds3elyzsm5avr7, which will be the service we are reviewing today.

Like our previous review of Amber, Nostr.Build is a service for users to pair with other Nostr apps. You won't generally use nostr:npub1nxy4qpqnld6kmpphjykvx2lqwvxmuxluddwjamm4nc29ds3elyzsm5avr7 by itself. Rather, you'll use it to host that incredible shot you want to post to #Olas, or to host screenshots for your long-form tutorial about setting up Nostr Wallet Connect that you'll be posting from #Habla.news, or for hosting a hilarious video of your cat falling asleep to nostr:npub1cj8znuztfqkvq89pl8hceph0svvvqk0qay6nydgk9uyq7fhpfsgsqwrz4u's voice and taking a tumble off of his favorite perch that you want to share on #Damus. However, there are some features within Nostr.Build that you may want to check out quite apart from using it with any other Nostr app.

Overall Impression

Score: 4.8 / 5

I have been impressed by Nostr.Build for some time now, but they have pulled out all the stops in their latest update, increasing their maximum file size for free accounts to 100MB, integrating the #Blossom protocol, adding the ability to share directly to Nostr from within your dashboard, and more integrations with other Nostr apps than ever before. Nostr.Build is simply a pleasure to use, whether through their web interface, or through another Nostr app that integrates with them.

With the ability to easily organize your media, view statistics, browse the media gallery of free uploads, metadata removal for increased privacy, and AI image generation, Nostr.Build is not simply a media hosting service, it is a full-fledged media management platform. Its robust features keep it well ahead of other Nostr-focused media hosting options available, and a particularly strong option for those using Blossom and wanting redundancy and reliable uptime for their media.

As much as I enjoy using the web interface, though, where Nostr.Build really shines is their integrations with other Nostr apps. These integrations allow users to have the same experience they are accustomed to from centralized social platforms of uploading their media from within the same app they are using to share it. No copy/pasting a URL from one app to another. In fact, many users may not realize they have been using Nostr.Build in their client of choice, simply because it is the default option for media hosting for many Nostr apps.

This has the added benefit to client developers that they can provide this experience to their users without having to run media hosting infrastructure on top of trying to build their app. The separation of relays, clients, and media hosting between different entities, while keeping a similar experience to centralized platforms where a single company controls all three, is critical to Nostr adoption.

Features

Nostr.Build has a plethora of features beyond simply hosting your media. Let's take a look!

AI Image Generation

Do you need a quick title image for a long-form article? How about inspiration for a logo or art piece? Nostr.Build's AI Studio has you covered.

They have provided a few different models based on the plan you purchase, beginning with the Professional plan, which includes SDXL-Lightning and Stable Diffusion 1. Upgrading to the Creator plan will give you access to all Pro Stable Diffusion models and unlimited use of the Flux.1 model, which is the same core model used for Grok2 images.

I personally have a Professional account, so I haven't had a chance to try out Flux.1, but I have used Stable Diffusion extensively for creating character art for #NostrHeroes characters, such as these:

Nothing too spectacular when compared with some of the newer models out there, and there is no image-to-image support (yet), but more than adequate for casual image generation needs. Moreover, it is far more than what one would expect from a simple media-hosting service.

Admittedly, I am also no expert at coaxing AI models to produce anything remarkable so your results may vary. Either way, image generation is a welcome tool to have available without needing to go to an outside service unless you require something very specific.

Upload Limits

The maximum file size limits on Nostr.Build have been getting progressively larger, even for their free service. As I recall, it was a mere 21MB limit per file just a few months ago, which is fine for image files, but is quickly exceeded with videos. Then they increased their limits to 50MB per file, and as of recent updates it has been increased once more to a whopping 100MB per file... for free! This is more than adequate for most uses.

However, free users' images, GIFs, and videos are automatically viewable via Nostr.Build's free media gallery. This is something to particularly bear in mind when uploading images you intend to share via direct message. Though your DMs are encrypted, the images uploaded to Nostr.Build are not, and if you don't have a paid account, they will be viewable to the all paid users in the free media gallery. If you want to upload images that will not be viewable unless you actively share them, you must have a paid account.

Paid accounts have no file size limit, but they do have a total storage limit. I could not find anything about total storage limits for free accounts, but Professional tier will give you 25GB, Creator 50GB, and Advanced 250GB. Uploads to paid accounts are not visible in the free media gallery, so only those you give the link to will be able to access your content.

Media Types

Many file types are supported by Nostr.Built, even for free users, including:

• Image: .jpg, .png, .gif
• Video: .mov, mp4
• Audio: mp3, .wav

Upgrading to the Professional plan will add .pdf and .svg to the list of permitted file types, and upgrading to Creator or above will add .zip files, as well.

I believe other common file types are also supported, but these are the only ones specifically mentioned on the site.

Free Media Gallery

The free media gallery is an interesting little feature that Nostr.Build has available to paid accounts. Free users can get a preview, such as the one below, but only paid users can browse through the millions of uploads made by free users.

Apart from being amusing to browse through the things people have been uploading, I am unsure of how useful this particular feature is. No indication is given as to who uploaded the media, and it is limited compared to media feeds in other Nostr apps in two important ways. First, it only shows media uploaded to Nostr.Build, while other media-focused Nostr apps, such as Slidestr, Lumina, or even Primal will show media posted by all Nostr users. Second, Nostr.Build's gallery doesn't show all uploads to Nostr.Build, but only uploads from those without a paid account, further limiting the scope of whose uploads are seen.

Paid users have the advantage of being able to upload media that is not viewable to anyone unless they intentionally share the link somewhere. Free users, on the other hand, must be aware that their uploads are viewable by any paid users, whether they shared the link anywhere or not.

One incident I had while testing out another app required me to reach out to Nostr.Build support to request deletion of an image. It had some of my personal information in it, and had been uploaded to Nostr.Build and sent to me via DM. The sender assumed that since it was being sent via DM, no one else would be able to see the image, but because he was not a paid user of Nostr.Build, the image was included in the Free Media Gallery for any paid user to see. Not ideal, but the folks at Nostr.Build were quick to get it deleted for me.

In short, I have mixed feelings about this particular feature.

Blossom

Blossom is a media storage and retrieval protocol built for Nostr, but usable with any application that needs to access media via the web, and Nostr.Build has recently added support for Blossom uploads via their Blossom server: blossom.band

I will likely be adding a Nostrversity article going over Blossom in detail in the near future, but here's the basics of what it makes possible:

First, easy integration for media uploading from your favorite Nostr apps. Amethyst, Coracle, Primal and others have added Blossom upload support, so you just have to hop into your settings and add Nostr.Build's Blossom server address to start using it as your media host. No need to go to a separate app to upload your media and copy/paste the URL into your Nostr note!

Second, your media in Blossom is content addressable. This means it is named based on a hash of its actual data. Because of this, you can verify that the media has not been altered or replaced by your media host. If the hash doesn't match the data, it won't be loaded by the Nostr client, so you never have to worry about the image in your note being replaced by a different image by your media host.

Finally, because your media is addressable by its content, you can save the same media to multiple hosts, and if one of them goes down, Nostr apps can fetch your media from other hosts, just like they can do with your notes by fetching them from different relays if one relay you write to is down. This makes your images and videos much harder to censor, since you would need to be banned by multiple Blossom servers for your media to no longer be accessible.

If you would like to upload media to more than one Blossom server at the same time, your options are currently to use Primal and ensure that your settings have "Enable media mirrors" toggled on, or to use Bouquet. Hopefully we will see this option added to more Nostr apps in the near future.

Metadata Stripping

For files uploaded via Nostr.Build's dashboard, location metadata is removed upon upload. This is to protect user privacy, since this data could be used to reveal your home address if it is left attached to images posted publicly on Nostr.

When uploading via Blossom, media containing location metadata will be rejected. The user will be required to remove the metadata before they can upload the media.

No KYC and No Ads Policy

The only form of identification needed to use Nostr.Build is your Nostr identity. Every upload is tied to your npub, but no name, date of birth, email, or other identifying information is required. This is made possible because Nostr.Build only accepts Bitcoin as payment for their accounts, and no KYC is required to make Bitcoin transactions via Lightning.

Additionally, Nostr.Build is philosophically opposed to targeted advertising, so they have a policy that they will never use ads on their hosting service.

Client Integrations

Even before Blossom, Nostr.Build had many Nostr clients that used it as the default media hosting service, allowing users to upload directly within the app. This has only expanded now that Nostr.Build has added Blossom.

A very non-exhaustive list of clients that integrate with Nostr.Build is listed on their site, and includes Damus, Amethyst, Nostrudel, Snort, Iris, Coracle, Flycat, and Yakihonne. Additional apps that support Nostr.Build via Blossom include Primal and Flotilla. Some of these integrations support both Blossom and NIP-96 options for uploading media, such as Amethyst, while others only support one or the other.

I would not be surprised to see more and more Nostr apps move to integrating Blossom and phasing out NIP-96 support. Either way, though, Nostr.Build currently supports both, and is therefore an excellent hosting option if you want to use it with a wide range of Nostr apps.

Media Statistics

For those with a paid account, Nostr.Build provides information about how often each of your uploads has been requested and viewed within a given time period.

This can be valuable information for content creators, so they can determine what content is resonating with their audience, and what times of day their posts get the most views.

This information can currently be viewed for a maximum period of three months prior to the current date, and as short a period as just the past hour.

Can My Grandma Use It?

Score: 4.7 / 5

Nostr.Build is incredibly easy to use if you have a paid account, or if you are a free user uploading to Nostr.Build through a client that integrates with them by default. Previous frictions encountered by free users trying to upload large files should now be few and far between, thanks to the generous 100MB size limit.

Where things may be a bit more involved is when users are trying to set up media hosting on Nostr apps that don't use Nostr.Build by default. Exactly where in the settings the user must go to set this up, and whether to use the Blossom or NIP-96 address may not be immediately apparent, and requires an understanding of the difference that the user may not possess. This is not the fault of Nostr.Built, though, and I have not taken it into consideration in the scoring. Each individual Nostr app's settings should be as easy to understand as possible.

Another point of friction may come from free users who want to upload directly through the Nostr.Build site, instead of via another Nostr app. This used to be possible without logging in, but in an effort to ensure the service was used for Nostr, and not for general media hosting, Nostr.Build added the requirement to log in.

Thankfully, there are plenty of login options, including npub and password, browser extension (NIP-07), and even via a one-time-code sent to you via Nostr DM. However, if you don't have a paid account already, logging in will prompt you to upgrade. It seems that uploading directly via the website has been removed for free users entirely. You can only upload via another Nostr app if you don't have a paid account. This may lead to confusion for users who don't want to pay for an account, since it isn't made apparent anywhere that uploading through the website isn't an option for them.

Additionally, I would like to see the addresses for the Blossom server and for NIP-96 uploads (unless they are being phased out) added to the main page somewhere. Even selecting the "Blossom" page from the site navigation doesn't make clear what needs to be done to utilize the service. Something as simple as, "To use Nostr.Build with your favorite Blossom compatible Nostr apps, just add https://blossom.band as your media host in the app settings," would be enough to point users in the right direction.

For those who do have paid accounts, the dashboard is easy to navigate and organize your media.

By default, all uploads are added to the Main Folder. Users can leave them there, or they can easily create new folders and drag and drop media to organize it.

Every image has a copy/paste clipboard icon for ready access to copy the media URL for inclusion into a Nostr note.

Additionally, Nostr.Build allows users to share their uploaded media to Nostr directly from the dashboard. Bear in mind, though, this is published to a set of popular relays, without taking into account the user's preferred write relays.

The section just below the user's profile information gives an at-a-glance view of important information, such as how much of the user's allotted storage has been used, how many AI Studio credits are available, how many days are left before their paid account must be renewed, and how many files from three major categories — GIFs, images, and videos — have been uploaded.

Uploading directly to the dashboard is also incredibly easy. You can simply drag and drop files into the upload pane, or browse for them. If you have a URL for the media you want to upload, you can even paste it to import from another website or Blossom server.

Anything I could think of that I might want to do in the interface was intuitive to find, well labeled, or had common and easily identified icons.

How do UI look?

Score: 4.7 / 5

I would describe Nostr.Build's UI as clean and utilitarian, which is what one would expect from a media hosting service. Nothing too flashy. Just what you need and nothing you don't.

We certainly like our purple color-schemes on Nostr, and Nostr.Build leans into that with white text on shades of purple backgrounds, along with occasional color-popping accents. If a Nostr client had made the same color choices, I might be a bit more critical, but it works in an app that users won't be spending a ton of time in, except while managing their media, or using the AI Studio to generate some images.

UI elements such as buttons, active folder indicators, and icons all maintain an attractive, and simple design, with rounded corners wherever appropriate. Nothing looks too busy or overbearing, and the spacing between image previews in the folder view is just right.

Font remains consistent throughout the interface, with no jarring changes, and bold text, in white or another contrasting color, is used appropriately to draw attention, while subdued text is rendered in a light purple to blend more with the background, while remaining readable.

As such, the UI is attractive, without being particularly breathtaking. Nothing to complain about, but also nothing to write home about.

Log In Options

Score: 4.8 / 5

As mentioned previously, Nostr.Build provides three ways a user can log in.

The first should be very familiar for any Nostr user who frequents web clients, and that is by use of a browser extension (NIP-07), such as Alby, Nos2x, or Gooti. Note, this will also work if you are on Android and using KeyChat's browser, which has a NIP-07 signer built in.

Next is the legacy login method for Nostr.Build that they have used since the service first launched, which is via npub and password. This should serve to remind you that even though Nostr.Build supports Nostr login, and can post your images to Nostr for you, it's really just a centralized media hosting service. Just like you wouldn't use only one Nostr relay, you should not use just one media host. Mirror your media to other Blossom servers.

Most intriguing, and one I had not seen used before, is the option to use your npub and have a one-time-code sent to you via Nostr DM. I tested this method out and it worked flawlessly. It is unfortunately using the old NIP-04 DM spec, though, so any clients that have deprecated these DMs will not work for receiving the code. We're in a strange place with Nostr DMs currently, with some clients deprecating NIP-04 DMs in favor of NIP-17, others that still only support NIP-04, and a few that support both. If you don't see the DM in your client of choice, hop over to Primal and check your DMs there in the "other" tab.

Since Nostr.Build is supporting Nostr login, I would like to see them add remote signer (NIP-46) login alongside browser extension login to round out the options expected from a Nostr web app.

Feature Set

Score: 4.8 / 5

The features provided by Nostr.Build all work as expected and provide a lot of value to the user. With only one exception, all of the features make sense for a media hosting and management service to provide, and they are adding more features all the time.

Users not only get a reliable hosting service, with excellent uptime for their media, but they get integrations with most Nostr clients I can think of, Blossom protocol support, media organization and statistics, posting media to Nostr from within the dashboard, metadata stripping for enhanced privacy, a wide range of supported file types, and an AI image generation studio! What's more, there are additional features already on the roadmap, including traditional and AI image editing, additional plan options, expandable storage, and video transcoding for optimized playback. Nostr.Build is just getting started and they already offer more than most media hosting services out there, intended for Nostr or otherwise.

The one feature I am still not sold on is the "Free Media Gallery." The name is misleading. The gallery itself is not free. You must have a paid account to access more than a preview of it. Rather, it displays media uploaded by free users, regardless of whether they uploaded that media to send via DM, or uploaded it but decided not to share it out, or uploaded it to post it only within a private group on Flotilla, or uploaded it and only sent the note with the image link to a private relay.

Moreover, if I want to see media that has been shared on Nostr, there are plenty of ways I can do so that I can be confident only include media users intended to be publicly viewable. This feature from Nostr.Build, if it is kept at all, should have some way of ensuring the gallery only includes images that were shared on public relays.

Pricing

Score: 5 / 5

The pricing structure for Nostr.Build is exceptionally reasonable when compared with other services.

The Professional plan, which is their lowest paid tier, is just 69,000 sats a year. At current price, that translates to around $70 for the year, and Nostr.Build has been known to lower their pricing as Bitcoin goes up. Users can also get a 10% or 20% discount if they buy 2 or 3 years at a time, compensating for the fact that Bitcoin tends to go up year over year.

For that cost, users get 25GB of storage, unlimited file size for uploads within that storage cap, and access to all of Nostr.Build's features mentioned in this review, with the exception of their highest end AI models and storage of certain file types.

If I were to set up my own VPS to host a Blossom server with comparable storage, I would be paying around $14 a month before the cost of the domain, and it would be anything but plug and play. Even then, all I would have is storage. I would be missing out on all of the other features Nostr.Build has out of the box for less than half the price.

The Creator plan is close to double the cost at 120,000 sats, or about $120, a year. However, you aren't just getting double the storage space at 50GB; you are also getting double the AI credits, access to the higher tier AI models, S3 backup for all of your media, and your own Creator page you can share out with your media available for others to browse in one location.

The Advanced plan doesn't add a lot of extra features for more than double the price of the Creator plan, but it MASSIVELY increases your storage limit by 5x to a total of 250GB. Comparable storage space on a VPS to run your own Blossom server would be about $100 a month and Nostr.Build is offering it for about $250 (250,000 sats) for a whole year! If you really need to host that much media, it's hard to beat this price. The plan also comes with a Nostr.Build NIP-05 address, if you need one.

Now, the argument can be made, "But it's priced in sats, and that means in four years I will have spent many times that dollar amount on their service, possibly making it more expensive than other services priced in fiat." While that is true, it also doesn't take opportunity cost into account. Every dollar you spend on something other than Bitcoin is a missed opportunity to have bought Bitcoin with it. There's not really any difference between spending $70 in fiat to buy a hosting plan vs spending 69,000 sats, because you could have used that same $70 to buy Bitcoin instead, so you are losing out on that increase in purchasing power either way.

Not to mention, you can just buy the sats with your fiat and send it to Nostr.Build, so you would effectively be buying your plan with fiat, and they would be receiving sats.

I think Satellite.earth is still technically less expensive at just $0.05 per GB per month, which comes to $15 a year for the same 25GB of Nostr.Build's professional plan. However, all you get is media hosting. You miss out on all of the other features provided by Nostr.Build. And if you are uploading files of 100MB or less... Well, free with Nostr.Build is still cheaper than $0.5 per GB.

Wrap Up

All of the above comes together to make Nostr.Build a versatile and full-featured media hosting and management service at an affordable price point for their paid accounts, but with no need to pay at all if you just want a place to upload photos, GIFs, memes, and even some videos, so long as the file size stays under 100MB. Whether you want to use Nostr.Build as your primary media host, or as just one redundancy in your Blossom set up, they have you covered and I encourage you to check them out!

For the next review, I would like to go with another client, this time for the web, and the two options I am debating between are Coracle.social and Jumble.social. Let me know in the comments which you would like to see!

@ 06b7819d:d1d8327c

In June 2023, the Law Commission of England and Wales published its final report on digital assets, concluding that the existing common law is generally flexible enough to accommodate digital assets, including crypto-tokens and non-fungible tokens (NFTs).

However, to address specific areas of uncertainty, the Commission recommended targeted statutory reforms and the establishment of an expert panel.

Key Conclusions and Recommendations:

1.  Recognition of a Third Category of Personal Property:

Traditional English law classifies personal property into two categories: “things in possession” (tangible items) and “things in action” (enforceable rights). Digital assets do not fit neatly into either category. The Commission recommended legislation to confirm the existence of a distinct third category of personal property to better accommodate digital assets. 

1. Development of Common Law: The Commission emphasized that the common law is well-suited to adapt to the complexities of emerging technologies and should continue to evolve to address issues related to digital assets. 

2. Establishment of an Expert Panel: To assist courts in navigating the technical and legal challenges posed by digital assets, the Commission recommended that the government create a panel of industry experts, legal practitioners, academics, and judges. This panel would provide non-binding guidance on issues such as control and transfer of digital assets. 

3. Facilitation of Crypto-Token and Crypto-Asset Collateral Arrangements: The Commission proposed the creation of a bespoke statutory legal framework to facilitate the use of digital assets as collateral, addressing current legal uncertainties in this area. 

4. Clarification of the Financial Collateral Arrangements Regulations: The report recommended statutory amendments to clarify the extent to which digital assets fall within the scope of the Financial Collateral Arrangements (No 2) Regulations 2003, ensuring that existing financial regulations appropriately cover digital assets. 

Overall, the Law Commission’s report underscores the adaptability of English common law in addressing the challenges posed by digital assets, while also identifying specific areas where legislative action is necessary to provide clarity and support the evolving digital economy.

@ 418a17eb:b64b2b3a

In today’s world, many people chase after money. We often think that wealth equals success and happiness. But if we look closer, we see that money is just a tool. The real goal is freedom.

Money helps us access resources and experiences. It can open doors. But the constant pursuit of wealth can trap us. We may find ourselves stressed, competing with others, and feeling unfulfilled. The more we chase money, the more we might lose sight of what truly matters.

Freedom, on the other hand, is about choice. It’s the ability to live life on our own terms. When we prioritize freedom, we can follow our passions and build meaningful relationships. We can spend our time on what we love, rather than being tied down by financial worries.

True fulfillment comes from this freedom. It allows us to define success for ourselves. When we embrace freedom, we become more resilient and creative. We connect more deeply with ourselves and others. This sense of purpose often brings more happiness than money ever could.

In the end, money isn’t the ultimate goal. It’s freedom that truly matters. By focusing on living authentically and making choices that resonate with us, we can create a life filled with meaning and joy.

@ 06b7819d:d1d8327c

The system design and challenges of retail Central Bank Digital Currencies (CBDCs) differ significantly from Bitcoin in several key aspects, reflecting their distinct purposes and underlying philosophies:

1. Core Purpose and Issuance

   • CBDCs: Issued by central banks, CBDCs are designed as state-backed digital currencies for public use. Their goal is to modernize payments, enhance financial inclusion, and provide a risk-free alternative to private money. • Bitcoin: A decentralized, peer-to-peer cryptocurrency created to operate independently of central authorities. Bitcoin aims to be a store of value and medium of exchange without reliance on intermediaries or governments.

2. Governance and Control

   • CBDCs: Operate under centralized governance. Central banks retain control over issuance, transaction validation, and data management, allowing for integration with existing regulatory frameworks (e.g., AML and CFT). • Bitcoin: Fully decentralized, governed by a consensus mechanism (Proof of Work). Transactions are validated by miners, and no single entity controls the network.

3. Privacy

   • CBDCs: Seek to balance privacy with regulatory compliance. Privacy-enhancing technologies may be implemented, but user data is typically accessible to intermediaries and central banks to meet regulatory needs. • Bitcoin: Pseudonymous by design. Transactions are public on the blockchain but do not directly link to individual identities unless voluntarily disclosed.

4. System Design

   • CBDCs: May adopt a hybrid system combining centralized (e.g., central bank-controlled settlement) and decentralized elements (e.g., private-sector intermediaries). Offline functionality and interoperability with existing systems are priorities. • Bitcoin: Fully decentralized, using a distributed ledger (blockchain) where all transactions are validated and recorded without reliance on intermediaries.

5. Cybersecurity

   • CBDCs: Cybersecurity risks are heightened due to potential reliance on centralized points for data storage and validation. Post-quantum cryptography is a concern for future-proofing against quantum computing threats. • Bitcoin: Security relies on cryptographic algorithms and decentralization. However, it is also vulnerable to quantum computing in the long term, unless upgraded to quantum-resistant protocols.

6. Offline Functionality

   • CBDCs: Exploring offline payment capabilities for broader usability in remote or unconnected areas. • Bitcoin: Offline payments are not natively supported, although some solutions (e.g., Lightning Network or third-party hardware wallets) can enable limited offline functionality.

7. Point of Sale and Adoption

   • CBDCs: Designed for seamless integration with existing PoS systems and modern financial infrastructure to encourage widespread adoption. • Bitcoin: Adoption depends on merchant willingness and the availability of cryptocurrency payment gateways. Its volatility can discourage usage as a medium of exchange.

8. Monetary Policy and Design

   • CBDCs: Can be programmed to support specific policy goals, such as negative interest rates, transaction limits, or conditional transfers. • Bitcoin: Supply is fixed at 21 million coins, governed by its code. It is resistant to monetary policy interventions and inflationary adjustments.

In summary, while CBDCs aim to complement existing monetary systems with centralized oversight and tailored features, Bitcoin is designed as a decentralized alternative to traditional currency. CBDCs prioritize integration, control, and regulatory compliance, whereas Bitcoin emphasizes autonomy, censorship resistance, and a trustless system.

@ c3b2802b:4850599c

Heute, am 9. Mai 2025 – genau 80 Jahre nach dem Ende des Zweiten Weltkriegs, der 60 Millionen Menschen das Leben kostete, darunter 27 Millionen Sowjetbürgern, erheben wir, die Bürgerinnen und Bürger Europas, unsere Stimmen! Wir schämen uns für unsere Regierungen und die EU, die die Lehren des 20. Jahrhunderts nicht gelernt haben. Die EU, einst als Friedensprojekt gedacht, wurde pervertiert und hat damit den Wesenskern Europas verraten! Wir, die Bürger Europas, nehmen darum heute, am 9. Mai, unsere Geschicke und unsere Geschichte selbst in die Hand. Wir erklären die EU für gescheitert. Wir beginnen mit Bürger-Diplomatie und verweigern uns dem geplanten Krieg gegen Russland! Wir erkennen die Mitverantwortung des „Westens“, der europäischen Regierungen und der EU an diesem Konflikt an.

Wir, die Bürger Europas, treten mit dem European Peace Project der schamlosen Heuchlerei und den Lügen entgegen, die heute – am Europatag – auf offiziellen Festakten und in öffentlichen Sendern verbreitet werden.

Wir strecken den Bürgerinnen und Bürgern der Ukraine und Russlands die Hand aus. Ihr gehört zur europäischen Familie, und wir sind überzeugt, dass wir gemeinsam ein friedliches Zusammenleben auf unserem Kontinent organisieren können.

Wir haben die Bilder der Soldatenfriedhöfe vor Augen – von Wolgograd über Riga bis Lothringen. Wir sehen die frischen Gräber, die dieser sinnlose Krieg in der Ukraine und in Russland hinterlassen hat. Während die meisten EU-Regierungen und Verantwortlichen für den Krieg hetzen und verdrängen, was Krieg für die Bevölkerung bedeutet, haben wir die Lektion des letzten Jahrhunderts gelernt: Europa heißt „Nie wieder Krieg!“

Wir erinnern uns an die europäischen Aufbauleistungen des letzten Jahrhunderts und an die Versprechen von 1989 nach der friedlichen Revolution. Wir fordern ein europäisch-russisches Jugendwerk nach dem Vorbild des deutsch-französischen Jugendwerks von 1963, das die „Erbfeindschaft“ zwischen Deutschland und Frankreich beendet hat. Wir fordern ein Ende der Sanktionen und den Wiederaufbau der Nord Stream II-Pipeline. Wir weigern uns, unsere Steuergelder für Rüstung und Militarisierung zu verschwenden, auf Kosten von Sozialstandards und Infrastruktur. Im Rahmen einer OSZE-Friedenskonferenz fordern wir die Schaffung einer europäischen Sicherheitsarchitektur mit und nicht gegen Russland, wie in der Charta von Paris von 1990 festgelegt. Wir fordern ein neutrales, von den USA emanzipiertes Europa, das eine vermittelnde Rolle in einer multipolaren Welt einnimmt. Unser Europa ist post-kolonial und post-imperial.

Wir, die Bürger Europas, erklären diesen Krieg hiermit für beendet! Wir machen bei den Kriegsspielen nicht mit. Wir machen aus unseren Männern und Söhnen keine Soldaten, aus unseren Töchtern keine Schwestern im Lazarett und aus unseren Ländern keine Schlachtfelder.

Wir bieten an, sofort eine Abordnung europäischer Bürgerinnen und Bürger nach Kiew und Moskau zu entsenden, um den Dialog zu beginnen. Wir werden nicht länger zusehen, wie unsere Zukunft und die unserer Kinder auf dem Altar der Machtpolitik geopfert wird.

Es lebe Europa, es lebe der Friede, es lebe die Freiheit

Auf der Webseite der Initiative oder in einem Gespräch mit Ulrike Guérot können Sie, liebe Leser, weitere Möglichkeiten erfahren, diese Friedensinitiative zu stärken! Danke an die IntiatorInnen und die bislang 15.000 Menschen, die das mitgestalten werden.

Dieser Beitrag wurde mit dem Pareto-Client geschrieben.

@ 4cebd4f5:0ac3ed15

TỔNG QUAN HACKATHON

Stellar Build Better Hackathon kết thúc thành công với 220 developervà84 dự ánđược phê duyệt. Sự kiện tập trung ứng dụngsmart contractscủa Stellar vào giải pháp thực tế, thúc đẩy hợp tác cộng đồng và tiến bộ công nghệ. Tổng giải thưởng 25.000 USD (USDC) được phân bổ cho 3 hạng mục: Better Finance (Tài chính tốt hơn), Better Creativity (Sáng tạo tốt hơn) và Better Access (Tiếp cận tốt hơn).

Các developer khám phá nhiều lĩnh vực như công cụ tiếp cận DeFi, giải pháp thanh toán xuyên biên giới, nền tảng cho creator economy, và hệ thống định danh số. Hackathon còn mang đến cơ hội kết nối với developer toàn cầu và các công ty crypto hàng đầu, cùng workshop kỹ thuật và demo trực tiếp.

Thành tựu nổi bật:

• Giải Nhất (12.000 USDC): Dự án cải thiện tiếp cận tài chính.

• Giải Nhì (8.000 USDC): Đổi mới công cụ sáng tạo.

• Giải Ba (5.000 USDC): Giải pháp tiếp cận đột phá.

Sự kiện khẳng định vai trò của Stellar trong thúc đẩy ứng dụng smart contracts mở rộng hệ sinh thái.

CÁC DỰ ÁN ĐOẠT GIẢI

Build Better Prizes

Giải Nhất
PayZoll_Stellar: Tích hợp AI và blockchain trong hệ sinh thái Stellar, cung cấp dịch vụ payroll toàn cầu tự động, minh bạch và bảo mật – nâng cao hiệu quả quản lý lương.

Giải Nhì
StellarFinance: Kết nối người dùng với cố vấn tài chính trên blockchain Stellar, đảm bảo dịch vụ tài chính minh bạch, tập trung vào tính toàn vẹn và trải nghiệm người dùng.

Giải Ba
Soroban to MCP Server in seconds + Policy Signers Playground: Chuyển đổi smart contracts Soroban (Stellar) thành máy chủ MCP cho tương tác ngôn ngữ tự nhiên, kích hoạt AI agents nâng cao chức năng hợp đồng thông minh.

Xem toàn bộ dự án tại DoraHacks.

THÔNG TIN ĐƠN VỊ TỔ CHỨC

Stellar Development Foundation

Tổ chức thúc đẩy phát triển mạng lưới Stellar – nền tảng blockchain tối ưu giao dịch xuyên biên giới. Với trọng tâm DeFi, Stellar triển khai dự án mở rộng tài chính toàn diện toàn cầu. Thông qua mạng lưới đối tác rộng lớn, tổ chức xây dựng giải pháp blockchain mở rộng, đảm bảo khả năng tiếp cận và độ tin cậy cho dịch vụ tài chính. Sứ mệnh của Stellar là kiến tạo cơ hội công bằng trong nền kinh tế toàn cầu qua công nghệ open-source đột phá.

@ 3bf0c63f:aefa459d

Report of how the money Jack donated to the cause in December 2022 has been misused so far.

Bounties given

March 2025

• Dhalsim: 1,110,540 - Work on Nostr wiki data processing

February 2025

• BOUNTY* NullKotlinDev: 950,480 - Twine RSS reader Nostr integration
• Dhalsim: 2,094,584 - Work on Hypothes.is Nostr fork
• Constant, Biz and J: 11,700,588 - Nostr Special Forces

January 2025

• Constant, Biz and J: 11,610,987 - Nostr Special Forces
• BOUNTY* NullKotlinDev: 843,840 - Feeder RSS reader Nostr integration
• BOUNTY* NullKotlinDev: 797,500 - ReadYou RSS reader Nostr integration

December 2024

• BOUNTY* tijl: 1,679,500 - Nostr integration into RSS readers yarr and miniflux
• Constant, Biz and J: 10,736,166 - Nostr Special Forces
• Thereza: 1,020,000 - Podcast outreach initiative

November 2024

• Constant, Biz and J: 5,422,464 - Nostr Special Forces

October 2024

• Nostrdam: 300,000 - hackathon prize
• Svetski: 5,000,000 - Latin America Nostr events contribution
• Quentin: 5,000,000 - nostrcheck.me

June 2024

• Darashi: 5,000,000 - maintaining nos.today, searchnos, search.nos.today and other experiments
• Toshiya: 5,000,000 - keeping the NIPs repo clean and other stuff

May 2024

• James: 3,500,000 - https://github.com/jamesmagoo/nostr-writer
• Yakihonne: 5,000,000 - spreading the word in Asia
• Dashu: 9,000,000 - https://github.com/haorendashu/nostrmo

February 2024

• Viktor: 5,000,000 - https://github.com/viktorvsk/saltivka and https://github.com/viktorvsk/knowstr
• Eric T: 5,000,000 - https://github.com/tcheeric/nostr-java
• Semisol: 5,000,000 - https://relay.noswhere.com/ and https://hist.nostr.land relays
• Sebastian: 5,000,000 - Drupal stuff and nostr-php work
• tijl: 5,000,000 - Cloudron, Yunohost and Fraidycat attempts
• Null Kotlin Dev: 5,000,000 - AntennaPod attempt

December 2023

• hzrd: 5,000,000 - Nostrudel
• awayuki: 5,000,000 - NOSTOPUS illustrations
• bera: 5,000,000 - getwired.app
• Chris: 5,000,000 - resolvr.io
• NoGood: 10,000,000 - nostrexplained.com stories

October 2023

• SnowCait: 5,000,000 - https://nostter.vercel.app/ and other tools
• Shaun: 10,000,000 - https://yakihonne.com/, events and work on Nostr awareness
• Derek Ross: 10,000,000 - spreading the word around the world
• fmar: 5,000,000 - https://github.com/frnandu/yana
• The Nostr Report: 2,500,000 - curating stuff
• james magoo: 2,500,000 - the Obsidian plugin: https://github.com/jamesmagoo/nostr-writer

August 2023

• Paul Miller: 5,000,000 - JS libraries and cryptography-related work
• BOUNTY tijl: 5,000,000 - https://github.com/github-tijlxyz/wikinostr
• gzuus: 5,000,000 - https://nostree.me/

July 2023

• syusui-s: 5,000,000 - rabbit, a tweetdeck-like Nostr client: https://syusui-s.github.io/rabbit/
• kojira: 5,000,000 - Nostr fanzine, Nostr discussion groups in Japan, hardware experiments
• darashi: 5,000,000 - https://github.com/darashi/nos.today, https://github.com/darashi/searchnos, https://github.com/darashi/murasaki
• jeff g: 5,000,000 - https://nostr.how and https://listr.lol, plus other contributions
• cloud fodder: 5,000,000 - https://nostr1.com (open-source)
• utxo.one: 5,000,000 - https://relaying.io (open-source)
• Max DeMarco: 10,269,507 - https://www.youtube.com/watch?v=aA-jiiepOrE
• BOUNTY optout21: 1,000,000 - https://github.com/optout21/nip41-proto0 (proposed nip41 CLI)
• BOUNTY Leo: 1,000,000 - https://github.com/leo-lox/camelus (an old relay thing I forgot exactly)

June 2023

• BOUNTY: Sepher: 2,000,000 - a webapp for making lists of anything: https://pinstr.app/
• BOUNTY: Kieran: 10,000,000 - implement gossip algorithm on Snort, implement all the other nice things: manual relay selection, following hints etc.
• Mattn: 5,000,000 - a myriad of projects and contributions to Nostr projects: https://github.com/search?q=owner%3Amattn+nostr&type=code
• BOUNTY: lynn: 2,000,000 - a simple and clean git nostr CLI written in Go, compatible with William's original git-nostr-tools; and implement threaded comments on https://github.com/fiatjaf/nocomment.
• Jack Chakany: 5,000,000 - https://github.com/jacany/nblog
• BOUNTY: Dan: 2,000,000 - https://metadata.nostr.com/

April 2023

• BOUNTY: Blake Jakopovic: 590,000 - event deleter tool, NIP dependency organization
• BOUNTY: koalasat: 1,000,000 - display relays
• BOUNTY: Mike Dilger: 4,000,000 - display relays, follow event hints (Gossip)
• BOUNTY: kaiwolfram: 5,000,000 - display relays, follow event hints, choose relays to publish (Nozzle)
• Daniele Tonon: 3,000,000 - Gossip
• bu5hm4nn: 3,000,000 - Gossip
• BOUNTY: hodlbod: 4,000,000 - display relays, follow event hints

March 2023

• Doug Hoyte: 5,000,000 sats - https://github.com/hoytech/strfry
• Alex Gleason: 5,000,000 sats - https://gitlab.com/soapbox-pub/mostr
• verbiricha: 5,000,000 sats - https://badges.page/, https://habla.news/
• talvasconcelos: 5,000,000 sats - https://migrate.nostr.com, https://read.nostr.com, https://write.nostr.com/
• BOUNTY: Gossip model: 5,000,000 - https://camelus.app/
• BOUNTY: Gossip model: 5,000,000 - https://github.com/kaiwolfram/Nozzle
• BOUNTY: Bounty Manager: 5,000,000 - https://nostrbounties.com/

February 2023

• styppo: 5,000,000 sats - https://hamstr.to/
• sandwich: 5,000,000 sats - https://nostr.watch/
• BOUNTY: Relay-centric client designs: 5,000,000 sats https://bountsr.org/design/2023/01/26/relay-based-design.html
• BOUNTY: Gossip model on https://coracle.social/: 5,000,000 sats
• Nostrovia Podcast: 3,000,000 sats - https://nostrovia.org/
• BOUNTY: Nostr-Desk / Monstr: 5,000,000 sats - https://github.com/alemmens/monstr
• Mike Dilger: 5,000,000 sats - https://github.com/mikedilger/gossip

January 2023

• ismyhc: 5,000,000 sats - https://github.com/Galaxoid-Labs/Seer
• Martti Malmi: 5,000,000 sats - https://iris.to/
• Carlos Autonomous: 5,000,000 sats - https://github.com/BrightonBTC/bija
• Koala Sat: 5,000,000 - https://github.com/KoalaSat/nostros
• Vitor Pamplona: 5,000,000 - https://github.com/vitorpamplona/amethyst
• Cameri: 5,000,000 - https://github.com/Cameri/nostream

December 2022

• William Casarin: 7 BTC - splitting the fund
• pseudozach: 5,000,000 sats - https://nostr.directory/
• Sondre Bjellas: 5,000,000 sats - https://notes.blockcore.net/
• Null Dev: 5,000,000 sats - https://github.com/KotlinGeekDev/Nosky
• Blake Jakopovic: 5,000,000 sats - https://github.com/blakejakopovic/nostcat, https://github.com/blakejakopovic/nostreq and https://github.com/blakejakopovic/NostrEventPlayground

@ 06b7819d:d1d8327c

The Bank of Amsterdam (Amsterdamse Wisselbank), established in 1609, played a pivotal role in the early history of banking and the development of banknotes. While banknotes as a concept had been pioneered in China centuries earlier, their modern form began emerging in Europe in the 17th century, and the Bank of Amsterdam leveraged its unique position to dominate this nascent monetary tool.

Founding and Early Innovations

The Bank of Amsterdam was created to stabilize and rationalize Amsterdam’s chaotic monetary system. During the early 1600s, a plethora of coins of varying quality and origin circulated in Europe, making trade cumbersome and unreliable. The Wisselbank provided a centralized repository where merchants could deposit coins and receive account balances in return, denominated in a standardized unit of account known as “bank money.” This “bank money” was more stable and widely trusted, making it an early form of fiat currency.

The Rise of Banknotes

Although the Wisselbank initially issued “bank money” as a ledger-based system, the growing demand for portable, trusted currency led to the adoption of transferable receipts or “banknotes.” These receipts acted as claims on deposited money and quickly became a trusted medium of exchange. The innovation of banknotes allowed merchants to avoid carrying large quantities of heavy coinage, enhancing convenience and security in trade.

Monopoly on Banknotes

The Wisselbank’s reputation for financial stability and integrity enabled it to establish a monopoly on banknotes in the Dutch Republic. The bank’s stringent policies ensured that its issued notes were fully backed by coinage or bullion, which bolstered trust in their value. By centralizing the issuance of notes, the bank eliminated competition from private or less reliable issuers, ensuring its notes became the de facto currency for merchants and traders.

Moreover, the bank’s policies discouraged the redemption of notes for physical coins, as it charged fees for withdrawals. This incentivized the circulation of banknotes rather than the underlying specie, cementing their role in the economy.

Decline of the Monopoly

The Wisselbank’s monopoly and influence lasted for much of the 17th century, making Amsterdam a hub of global trade and finance. However, as the 18th century progressed, financial mismanagement and competition from other emerging financial institutions eroded the Wisselbank’s dominance. By the late 18th century, its role in the global financial system had diminished, and other European financial centers, such as London, rose to prominence.

Legacy

The Bank of Amsterdam’s early monopolization of banknotes set a precedent for centralized banking and the development of modern monetary systems. Its ability to create trust in a standardized, portable medium of exchange foreshadowed the role that central banks would play in issuing and regulating currency worldwide.

@ a39d19ec:3d88f61e

Die Debatte um Migration, Grenzsicherung und Abschiebungen wird in Deutschland meist emotional geführt. Wer fordert, dass illegale Einwanderer abgeschoben werden, sieht sich nicht selten dem Vorwurf des Rassismus ausgesetzt. Doch dieser Vorwurf ist nicht nur sachlich unbegründet, sondern verkehrt die Realität ins Gegenteil: Tatsächlich sind es gerade diejenigen, die hinter jeder Forderung nach Rechtssicherheit eine rassistische Motivation vermuten, die selbst in erster Linie nach Hautfarbe, Herkunft oder Nationalität urteilen.

Das Recht steht über Emotionen

Deutschland ist ein Rechtsstaat. Das bedeutet, dass Regeln nicht nach Bauchgefühl oder politischer Stimmungslage ausgelegt werden können, sondern auf klaren gesetzlichen Grundlagen beruhen müssen. Einer dieser Grundsätze ist in Artikel 16a des Grundgesetzes verankert. Dort heißt es:

„Auf Absatz 1 [Asylrecht] kann sich nicht berufen, wer aus einem Mitgliedstaat der Europäischen Gemeinschaften oder aus einem anderen Drittstaat einreist, in dem die Anwendung des Abkommens über die Rechtsstellung der Flüchtlinge und der Europäischen Menschenrechtskonvention sichergestellt ist.“

Das bedeutet, dass jeder, der über sichere Drittstaaten nach Deutschland einreist, keinen Anspruch auf Asyl hat. Wer dennoch bleibt, hält sich illegal im Land auf und unterliegt den geltenden Regelungen zur Rückführung. Die Forderung nach Abschiebungen ist daher nichts anderes als die Forderung nach der Einhaltung von Recht und Gesetz.

Die Umkehrung des Rassismusbegriffs

Wer einerseits behauptet, dass das deutsche Asyl- und Aufenthaltsrecht strikt durchgesetzt werden soll, und andererseits nicht nach Herkunft oder Hautfarbe unterscheidet, handelt wertneutral. Diejenigen jedoch, die in einer solchen Forderung nach Rechtsstaatlichkeit einen rassistischen Unterton sehen, projizieren ihre eigenen Denkmuster auf andere: Sie unterstellen, dass die Debatte ausschließlich entlang ethnischer, rassistischer oder nationaler Kriterien geführt wird – und genau das ist eine rassistische Denkweise.

Jemand, der illegale Einwanderung kritisiert, tut dies nicht, weil ihn die Herkunft der Menschen interessiert, sondern weil er den Rechtsstaat respektiert. Hingegen erkennt jemand, der hinter dieser Kritik Rassismus wittert, offenbar in erster Linie die „Rasse“ oder Herkunft der betreffenden Personen und reduziert sie darauf.

Finanzielle Belastung statt ideologischer Debatte

Neben der rechtlichen gibt es auch eine ökonomische Komponente. Der deutsche Wohlfahrtsstaat basiert auf einem Solidarprinzip: Die Bürger zahlen in das System ein, um sich gegenseitig in schwierigen Zeiten zu unterstützen. Dieser Wohlstand wurde über Generationen hinweg von denjenigen erarbeitet, die hier seit langem leben. Die Priorität liegt daher darauf, die vorhandenen Mittel zuerst unter denjenigen zu verteilen, die durch Steuern, Sozialabgaben und Arbeit zum Erhalt dieses Systems beitragen – nicht unter denen, die sich durch illegale Einreise und fehlende wirtschaftliche Eigenleistung in das System begeben.

Das ist keine ideologische Frage, sondern eine rein wirtschaftliche Abwägung. Ein Sozialsystem kann nur dann nachhaltig funktionieren, wenn es nicht unbegrenzt belastet wird. Würde Deutschland keine klaren Regeln zur Einwanderung und Abschiebung haben, würde dies unweigerlich zur Überlastung des Sozialstaates führen – mit negativen Konsequenzen für alle.

Sozialpatriotismus

Ein weiterer wichtiger Aspekt ist der Schutz der Arbeitsleistung jener Generationen, die Deutschland nach dem Zweiten Weltkrieg mühsam wieder aufgebaut haben. Während oft betont wird, dass die Deutschen moralisch kein Erbe aus der Zeit vor 1945 beanspruchen dürfen – außer der Verantwortung für den Holocaust –, ist es umso bedeutsamer, das neue Erbe nach 1945 zu respektieren, das auf Fleiß, Disziplin und harter Arbeit beruht. Der Wiederaufbau war eine kollektive Leistung deutscher Menschen, deren Früchte nicht bedenkenlos verteilt werden dürfen, sondern vorrangig denjenigen zugutekommen sollten, die dieses Fundament mitgeschaffen oder es über Generationen mitgetragen haben.

Rechtstaatlichkeit ist nicht verhandelbar

Wer sich für eine konsequente Abschiebepraxis ausspricht, tut dies nicht aus rassistischen Motiven, sondern aus Respekt vor der Rechtsstaatlichkeit und den wirtschaftlichen Grundlagen des Landes. Der Vorwurf des Rassismus in diesem Kontext ist daher nicht nur falsch, sondern entlarvt eine selektive Wahrnehmung nach rassistischen Merkmalen bei denjenigen, die ihn erheben.

@ e516ecb8:1be0b167

Recentemente, o podcast Scicast apresentou um episódio sobre aposentadoria, descrevendo os diferentes sistemas e sua história. Acho que, embora tenha sido um episódio interessante, foi muito injusto com o sistema de financiamento privado, que, afinal de contas, para um podcast voltado para a ciência (e que mencionou várias vezes que o sistema de repartição era matematicamente inviável), achei que alguns pontos precisavam ser esclarecidos.

Não estou dizendo que o sistema chileno é perfeito, não é, mas ele tinha potencial para melhorar e a classe política só o tornou cada vez pior.

Por exemplo, Otto von Bismarck sabia que tornaria a população idosa (os poucos que atingiram a idade de aposentadoria) dependente do Estado, e foi isso que fez com que Franco adotasse o sistema na Espanha, onde hoje é preciso aumentar os impostos para manter artificialmente o sistema de repartição.

A rentabilidade é baixa no sistema chileno, porque há lacunas (meses sem pagar) e porque você só contribui com 10%. Ou seja, se seu salário for 100, mas você contribuir com 10 em janeiro e mais nenhum mês. No final da sua vida profissional (45 anos) você terá 450 mais os rendimentos 1350, e esse total dividido pela expectativa de vida que está cada vez mais alta: 20 anos (24 meses) dá um salário de 56,25. Muito baixo, porque para o cálculo o salário era 100. Ainda mais baixo se a inflação for levada em conta. Mas o fato de haver meses sem contribuições não é levado em conta.

Deve-se considerar na rentabilidade que, em média, para cada 1 peso contribuído, são obtidos 3 pesos.Según cálculos de comissões

Várias comissões foram criadas para estudar como melhorar o sistema no Chile, e todas concluem a mesma coisa:

1- contribuir com 10% é muito baixo em comparação com outros sistemas

2- não se deve tolerar lacunas (a idade de aposentadoria não deve ser a idade natural, mas os anos de contribuição)

3- deve haver ajustes para cada aumento na expectativa de vida.

Esses três pontos acima não são tocados pelos políticos, porque são impopulares e eles vivem para a próxima eleição. Assim, eles preferem buscar outras formas, como o PGU (o salário básico universal que você já mencionou no podcast), que matematicamente já foi calculado como inviável no longo prazo.

Considere que 10% é baixo, mas ainda assim o Chile está muito bem classificado e poderia melhorar se os políticos tivessem a coragem de assumir os resultados das comissões que eles mesmos solicitaram.

https://www.65ymas.com/economia/pensiones/10-paises-con-mejores-sistemas-pensiones_22627_102.html

Foi mencionada a complexidade dos investimentos, o que é um mito, pois há fundos em que as contribuições são feitas de acordo com a idade do trabalhador (Fundo A para jovens, mais rentável, mas mais arriscado, e Fundo E, menos rentável, mas também menos arriscado). Na crise, as pessoas que perderam muito dinheiro foram porque estavam em um fundo que não correspondia à sua idade. Se você for jovem, poderá recuperar os retornos em um fundo de risco. Mas se for idoso na época da crise e não estiver em um fundo estável, já terá perdido sem poder se recuperar antes dos 65 anos.

Além disso, não se considera que há também um fundo voluntário adicional para o qual cada pessoa pode contribuir (APV), que tem benefícios como contribuições anuais do Estado para recompensar aqueles que contribuem para ele, e que também paga retornos.

Por outro lado, foi possível retirar dinheiro dos fundos individuais durante a crise pandêmica, algo que seria impossível em um fundo de repartição em que cada unidade monetária depositada por um trabalhador ativo é gasta ao mesmo tempo por um aposentado.

O modelo de repartição militar no Chile exige 20 anos de contribuições sem intervalos, qualquer intervalo e a pensão é de US$ 0, algo que não acontece no sistema civil (e não poderia acontecer porque o dinheiro lá é seu).

O sistema de capitalização individual no Chile permite que os trabalhadores possuam ativos de investimento, ativos de empresas que ajudaram o país a se desenvolver, algo que os políticos que querem derrubar o sistema parecem não entender.

E quanto à inflação? Investir em ativos que geram renda é útil tanto para mitigar a inflação quanto para ser proprietário, e esse último aspecto será relevante quando a automação chegar. Em vez de manter um registro artificial de quanto um robô produz, é mais transparente lucrar com os dividendos produzidos pela empresa em questão.

O sistema nórdico foi mencionado (que, afinal de contas, é praticamente o único sistema europeu que não está à beira do colapso). Vale a pena considerar que o dinheiro que a Noruega ganha com o petróleo vai para um fundo de investimento semelhante ao que temos individualmente no Chile, e a partir dele é paga grande parte do estado de bem-estar social norueguês. Mas isso é algo que parece muito distante, com a classe política latino-americana mais inclinada a desperdiçá-lo em bobagens populistas.

O modelo de distribuição é piramidal, embora possa parecer uma narrativa perigosa, é bom que as pessoas o vejam dessa forma (se um cidadão tirasse dinheiro dos jovens para dar aos idosos, provavelmente acabaria preso por um esquema ponzi), e a taxa de natalidade cada vez menor é um problema que o Estado não pode resolver, por mais totalitário que seja (estímulos fiscais e monetários etc. foram tentados com resultados ruins e míopes).

Além disso, por mais demonizado que seja na narrativa, o sistema chileno é um sistema misto com um pilar de solidariedade para aqueles que não contribuíram bem.

Na Argentina, passou-se da capitalização individual para o sistema de repartição, e o dinheiro foi usado pelos políticos quando não podiam pagar a conta de um Estado cada vez maior e corrupto, deixando os aposentados à mercê das migalhas dadas pelos políticos em cada campanha eleitoral. Você não confia no mercado, eu não confio no Estado.

@ 866e0139:6a9334e5

Autor: Nicolas Riedl. Dieser Beitrag wurde mit dem Pareto-Client geschrieben. Sie finden alle Texte der Friedenstaube und weitere Texte zum Thema Frieden hier. Die neuesten Pareto-Artikel finden Sie in unserem Telegram-Kanal.

Dieser Beitrag erschien zuerst bei Radio München.

---

Die neuesten Artikel der Friedenstaube gibt es jetzt auch im eigenen Friedenstaube-Telegram-Kanal.

---

Das Kriegsgrauen kriecht unter die Haut. Bilder von verstümmelten Beinen und Armen, von Kriegstraumatisierten schweigenden Männern, von Kriegsgräbern steigen auf. Als Mutter, Schwester, Tante, Großmutter wachsen die Ängste, dass sich ein Verwandter von der politischen und medialen Kriegslust anstecken lässt und tatsächlich die Beteiligung an den näher kommenden kriegerischen Auseinandersetzungen in Erwägung zieht. Einen wütenden Kommentar anlässlich der wachsenden Kriegstreiberei verfasste unser Autor Nicolas Riedl.

https://soundcloud.com/radiomuenchen/sofa-soldaten-an-die-front-von-nicolas-riedl?utm_source=clipboard&utm_campaign=wtshare&utm_medium=widget&utm_content=https%253A%252F%252Fsoundcloud.com%252Fradiomuenchen%252Fsofa-soldaten-an-die-front-von-nicolas-riedl

---

Nicolas Riedl, Jahrgang 1993, geboren in München, studierte Medien-, Theater- und Politikwissenschaften in Erlangen. Den immer abstruser werdenden Zeitgeist der westlichen Kultur dokumentiert und analysiert er in kritischen Texten. Darüber hinaus ist er Büchernarr, strikter Bargeldzahler und ein für seine Generation ungewöhnlicher Digitalisierungsmuffel. Entsprechend findet man ihn auf keiner Social-Media-Plattform. Von 2017 bis 2023 war er für die Rubikon-Jugendredaktion und Videoredaktion tätig.

---

LASSEN SIE DER FRIEDENSTAUBE FLÜGEL WACHSEN!

Hier können Sie die Friedenstaube abonnieren und bekommen die Artikel zugesandt.

Schon jetzt können Sie uns unterstützen:

• Für 50 CHF/EURO bekommen Sie ein Jahresabo der Friedenstaube.
• Für 120 CHF/EURO bekommen Sie ein Jahresabo und ein T-Shirt/Hoodie mit der Friedenstaube.
• Für 500 CHF/EURO werden Sie Förderer und bekommen ein lebenslanges Abo sowie ein T-Shirt/Hoodie mit der Friedenstaube.
• Ab 1000 CHF werden Sie Genossenschafter der Friedenstaube mit Stimmrecht (und bekommen lebenslanges Abo, T-Shirt/Hoodie).

Für Einzahlungen in CHF (Betreff: Friedenstaube):

Für Einzahlungen in Euro:

Milosz Matuschek

IBAN DE 53710520500000814137

BYLADEM1TST

Sparkasse Traunstein-Trostberg

Betreff: Friedenstaube

Wenn Sie auf anderem Wege beitragen wollen, schreiben Sie die Friedenstaube an: friedenstaube@pareto.space

---

Sie sind noch nicht auf Nostr and wollen die volle Erfahrung machen (liken, kommentieren etc.)? Zappen können Sie den Autor auch ohne Nostr-Profil! Erstellen Sie sich einen Account auf Start. Weitere Onboarding-Leitfäden gibt es im Pareto-Wiki.

@ 3f770d65:7a745b24

At the recent Launch Music Festival and Conference in Lancaster, PA, featuring over 120 musicians across three days, I volunteered my time with Tunestr and Phantom Power Music's initiative to introduce artists to Bitcoin, Nostr, and the value-for-value model. Tunestr sponsored a stage, live-streaming 21 bands to platforms like Tunestr.io, Fountain.fm and other Nostr/Podcasting 2.0 apps and on-boarding as many others as possible at our conference booth. You may have seen me spamming about this over the last few days.

V4V Earnings

Day 1: 180,000 sats

Day 2: 300,000 sats

Day 3: Over 500,000 sats

Who?

Here are the artists that were on-boarded to Fountain and were live streaming on the Value-for-Value stage:

nostr:npub1cruu4z0hwg7n3r2k7262vx8jsmra3xpku85frl5fnfvrwz7rd7mq7e403w nostr:npub12xeh3n7w8700z4tpd6xlhlvg4vtg4pvpxd584ll5sva539tutc3q0tn3tz nostr:npub1rc80p4v60uzfhvdgxemhvcqnzdj7t59xujxdy0lcjxml3uwdezyqtrpe0j @npub16vxr4pc2ww3yaez9q4s53zkejjfd0djs9lfe55sjhnqkh nostr:npub10uspdzg4fl7md95mqnjszxx82ckdly8ezac0t3s06a0gsf4f3lys8ypeak nostr:npub1gnyzexr40qut0za2c4a0x27p4e3qc22wekhcw3uvdx8mwa3pen0s9z90wk nostr:npub13qrrw2h4z52m7jh0spefrwtysl4psfkfv6j4j672se5hkhvtyw7qu0almy nostr:npub1p0kuqxxw2mxczc90vcurvfq7ljuw2394kkqk6gqnn2cq0y9eq5nq87jtkk nostr:npub182kq0sdp7chm67uq58cf4vvl3lk37z8mm5k5067xe09fqqaaxjsqlcazej nostr:npub162hr8kd96vxlanvggl08hmyy37qsn8ehgj7za7squl83um56epnswkr399 nostr:npub17jzk5ex2rafres09c4dnn5mm00eejye6nrurnlla6yn22zcpl7vqg6vhvx nostr:npub176rnksulheuanfx8y8cr2mrth4lh33svvpztggjjm6j2pqw6m56sq7s9vz nostr:npub1akv7t7xpalhsc4nseljs0c886jzuhq8u42qdcwvu972f3mme9tjsgp5xxk nostr:npub18x0gv872489lrczp9d9m4hx59r754x7p9rg2jkgvt7ul3kuqewtqsssn24

Many more musicians were on-boarded to Fountain, however, we were unable to obtain all of their npubs.

THANK YOU TO ALL ZAPPERS AND BOOSTERS!

Musicians “Get It”

My key takeaway was the musicians' absolute understanding that the current digital landscape along with legacy social media is failing them. Every artist I spoke with recognized how algorithms hinder fan connection and how gatekeepers prevent fair compensation for their work. They all use Spotify, but they only do so out of necessity. They felt the music industry is primed for both a social and monetary revolution. Some of them were even speaking my language…

Because of this, concepts like decentralization, censorship resistance, owning your content, and controlling your social graph weren't just understood by them, they were instantly embraced. The excitement was real; they immediately saw the potential and agreed with me. Bitcoin and Nostr felt genuinely punk rock and that helped a lot of them identify with what we were offering them.

The Tools and the Issues

While the Nostr ecosystem offers a wide variety of tools, we focused on introducing three key applications at this event to keep things clear for newcomers:

1. Fountain, with a music focus, was the primary tool for onboarding attendees onto Nostr. Fountain was also chosen thanks to Fountain’s built-in Lightning wallet.
2. Primal, as a social alternative, was demonstrated to show how users can take their Nostr identity and content seamlessly between different applications.
3. Tunestr.io, lastly was showcased for its live video streaming capabilities.

Although we highlighted these three, we did inform attendees about the broader range of available apps and pointed them to nostrapps.com if they wanted to explore further, aiming to educate without overwhelming them.

This review highlights several UX issues with the Fountain app, particularly concerning profile updates, wallet functionality, and user discovery. While Fountain does work well, these minor hiccups make it extremely hard for on-boarding and education.

• Profile Issues:
• When a user edits their profile (e.g., Username/Nostr address, Lightning address) either during or after creation, the changes don't appear to consistently update across the app or sync correctly with Nostr relays.
• Specifically, the main profile display continues to show the old default Username/Nostr address and Lightning address inside Fountain and on other Nostr clients.
• However, the updated Username/Nostr address does appear on https://fountain.fm (chosen-username@fountain.fm) and is visible within the "Edit Profile" screen itself in the app.
• This inconsistency is confusing for users, as they see their updated information in some places but not on their main public-facing profile within the app. I confirmed this by observing a new user sign up and edit their username – the edit screen showed the new name, but the profile display in Fountain did not update and we did not see it inside Primal, Damus, Amethyst, etc.
• Wallet Limitations:
• The app's built-in wallet cannot scan Lightning address QR codes to initiate payments.
• This caused problems during the event where users imported Bitcoin from Azte.co vouchers into their Fountain wallets. When they tried to Zap a band by scanning a QR code on the live tally board, Fountain displayed an error message stating the invoice or QR code was invalid.
• While suggesting musicians install Primal as a second Nostr app was a potential fix for the QR code issue, (and I mentioned it to some), the burden of onboarding users onto two separate applications, potentially managing two different wallets, and explaining which one works for specific tasks creates a confusing and frustrating user experience.
• Search Difficulties:
• Finding other users within the Fountain app is challenging. I was unable to find profiles from brand new users by entering their chosen Fountain username.
• To find a new user, I had to resort to visiting their profile on the web (fountain.fm/username) to retrieve their npub. Then, open Primal and follow them. Finally, when searching for their username, since I was now following them, I was able to find their profile.
• This search issue is compounded by the profile syncing problem mentioned earlier, as even if found via other clients, their displayed information is outdated.
• Searching for the event to Boost/Zap inside Fountain was harder than it should have been the first two days as the live stream did not appear at the top of the screen inside the tap. This was resolved on the third day of the event.

Improving the Onboarding Experience

To better support user growth, educators and on-boarders need more feature complete and user-friendly applications. I love our developers and I will always sing their praises from the highest mountain tops, however I also recognize that the current tools present challenges that hinder a smooth onboarding experience.

One potential approach explored was guiding users to use Primal (including its built-in wallet) in conjunction with Wavlake via Nostr Wallet Connect (NWC). While this could facilitate certain functions like music streaming, zaps, and QR code scanning (which require both Primal and Wavlake apps), Wavlake itself has usability issues. These include inconsistent or separate profiles between web and mobile apps, persistent "Login" buttons even when logged in on the mobile app with a Nostr identity, and the minor inconvenience of needing two separate applications. Although NWC setup is relatively easy and helps streamline the process, the need to switch between apps adds complexity, especially when time is limited and we’re aiming to showcase the benefits of this new system.

Ultimately, we need applications that are more feature-complete and intuitive for mainstream users to improve the onboarding experience significantly.

Looking forward to the future

I anticipate that most of these issues will be resolved when these applications address them in the near future. Specifically, this would involve Fountain fixing its profile issues and integrating Nostr Wallet Connect (NWC) to allow users to utilize their Primal wallet, or by enabling the scanning of QR codes that pay out to Lightning addresses. Alternatively, if Wavlake resolves the consistency problems mentioned earlier, this would also significantly improve the situation giving us two viable solutions for musicians.

My ideal onboarding event experience would involve having all the previously mentioned issues resolved. Additionally, I would love to see every attendee receive a $5 or $10 voucher to help them start engaging with value-for-value, rather than just the limited number we distributed recently. The goal is to have everyone actively zapping and sending Bitcoin throughout the event. Maybe we can find a large sponsor to facilitate this in the future?

What's particularly exciting is the Launch conference's strong interest in integrating value-for-value across their entire program for all musicians and speakers at their next event in Dallas, Texas, coming later this fall. This presents a significant opportunity to onboard over 100+ musicians to Bitcoin and Nostr, which in turn will help onboard their fans and supporters.

We need significantly more zaps and more zappers! It's unreasonable to expect the same dedicated individuals to continuously support new users; they are being bled dry. A shift is needed towards more people using bitcoin for everyday transactions, treating it as money. This brings me back to my ideal onboarding experience: securing a sponsor to essentially give participants bitcoin funds specifically for zapping and tipping artists. This method serves as a practical lesson in using bitcoin as money and showcases the value-for-value principle from the outset.

@ b6524158:8e898a89

Looking to break away from the defaults? In this tutorial, BTC Sessions show you how to run Bitcoin Knots (or switch over from Bitcoin Core) https://youtu.be/zT4NuAaH3EM?si=1MSNIqnicrkKBWBS

originally posted at https://stacker.news/items/976079

@ b8851a06:9b120ba1

The global financial system is creaking under its own weight. The IMF is urging banks to shore up capital, cut risk, and brace for impact. Basel III is their answer, a last-ditch effort to reinforce a brittle foundation.

But behind the scenes, a quieter revolution is under way.

Bitcoin, the world’s first stateless digital asset, is no longer on the sidelines. It’s entering the Basel conversation: not by invitation, but by inevitability.

Basel III: The System’s Self-Diagnosis

Basel III is more than a technical rulebook. It’s a confession: an admission that the global banking system is vulnerable. Created in the aftermath of 2008, it calls for: • Stronger capital reserves: So banks can survive losses. • Lower leverage: To reduce the domino effect of overexposure. • Liquidity buffers: To weather short-term shocks without collapsing.

But here’s the kicker: these rules are hostile to anything outside the fiat system. Bitcoin gets hit with a punitive 1,250% risk weight. That means for every $1 of exposure, banks must hold $1 in capital. The message from regulators? “You can hold Bitcoin, but you’ll pay for it.”

Yet that fear: based framing misses a bigger truth: Bitcoin doesn’t just survive in this environment. It thrives in it.

Bitcoin: A Parallel System, Built on Hard Rules

Where Basel III imposes “fiat discipline” from the top down, Bitcoin enforces it from the bottom up: with code, math, and transparency.

Bitcoin is not just a hedge. It’s a structural antidote to systemic fragility.

Volatility: A Strategic Asset

Yes, Bitcoin is volatile. But in a system that devalues fiat on a schedule, volatility is simply the cost of freedom. Under Basel III, banks are expected to build capital buffers during economic expansions.

What asset allows you to build those buffers faster than Bitcoin in a bull market?

When the cycle turns, those reserves act as shock absorbers: converting volatility into resilience. It’s anti-fragility in motion.

Liquidity: Real, Deep, and Global

Bitcoin settled over $19 trillion in transactions in 2024. That’s not hypothetical liquidity. it’s real, measurable flow. Unlike traditional high-quality liquid assets (HQLAs), Bitcoin is: • Available 24/7 • Borderless • Not dependent on central banks

By traditional definitions, Bitcoin is rapidly qualifying for HQLA status. Even if regulators aren’t ready to admit it.

Diversification: Breaking the Fiat Dependency

Basel III is designed to pull banks back into the fiat matrix. But Bitcoin offers an escape hatch. Strategic Bitcoin reserves are not about speculation, they’re insurance. For family offices, institutions, and sovereign funds, Bitcoin is the lifeboat when the fiat ship starts taking on water.

Regulatory Realignment: The System Reacts

The Basel Committee’s new rules on crypto exposures went live in January 2025. Around the world, regulators are scrambling to define their stance. Every new restriction placed on Bitcoin only strengthens its legitimacy, as more institutions ask: Why so much resistance, if it’s not a threat?

Bitcoin doesn’t need permission. It’s already being adopted by over 150 public companies, forward-looking states, and a new class of self-sovereign individuals.

Conclusion: The Real Question

This isn’t just about Bitcoin fitting into Basel III.

The real question is: How long can Basel III remain relevant in a world where Bitcoin exists?

Bitcoin is not the risk. It’s the reality check. And it might just be the strongest capital buffer the system has ever seen.

Gradually then suddenly.

@ 06b7819d:d1d8327c

Understanding Figure and Ground: How We Perceive the World

The concept of “figure and ground” originates from Gestalt psychology but takes on profound implications in Marshall McLuhan’s media theory. At its core, figure and ground describe the relationship between what we focus on (the “figure”) and the larger context that shapes and influences it (the “ground”). Together, they illustrate how perception is shaped not only by what we pay attention to, but by what we overlook.

Figure and Ground in Perception

Imagine looking at a photo of a tree in a forest. The tree might stand out as the figure—it’s what your attention is drawn to. However, the forest, the sky, and even the light conditions around the tree create the ground. These background elements are not immediately in focus, but they are essential to understanding the tree’s existence and meaning within its environment.

Our minds are naturally inclined to separate figure from ground, but this process often distorts our perception. By focusing on one aspect, we tend to neglect the broader context that gives it meaning. This principle applies not just to visual perception but also to the way we experience media, technology, and culture.

McLuhan’s Take: Media as Ground

For McLuhan, media and technology are the “ground” upon which all human activity takes place. We often fixate on the “figure” of a medium—the content it delivers—without recognizing the ground, which is the medium itself and its pervasive influence. For example, we might focus on the latest viral video (the figure) without reflecting on how platforms like TikTok (the ground) shape attention spans, social behaviors, and even our cultural norms.

McLuhan famously argued that “the medium is the message,” meaning the medium’s structure and characteristics influence society far more deeply than the specific content it carries. The figure (content) distracts us from examining the ground (medium), which often operates invisibly.

Figure and Ground in Daily Life

Consider smartphones. The apps, messages, and videos we interact with daily are the figures. The ground is the smartphone itself—a device that transforms communication, alters social dynamics, and restructures how we manage time and attention. Focusing solely on what’s displayed on the screen blinds us to the ways the device reshapes our lives.

Rebalancing Perception

To truly understand the impact of media and technology, McLuhan urged us to become aware of the ground. By stepping back and observing how the environment shapes the figure, we can better grasp the larger systems at work. This requires a shift in perspective: instead of asking “What does this content mean?” we might ask “How does this medium affect the way I think, behave, or relate to others?”

Understanding figure and ground helps us see the world more holistically, uncovering hidden dynamics that shape perception and culture. It’s a reminder that what we take for granted—what fades into the background—is often the most transformative force of all.

@ fd06f542:8d6d54cd

排名随机， 列表正在增加中。

Cody Tseng

jumble.social 的作者

https://jumble.social/users/npub1syjmjy0dp62dhccq3g97fr87tngvpvzey08llyt6ul58m2zqpzps9wf6wl

• Running [ wss://nostr-relay.app ] (free & WoT) 💜⚡️
• Building 👨‍💻:
• https://github.com/CodyTseng/jumble
• https://github.com/CodyTseng/nostr-relay-tray
• https://github.com/CodyTseng/danmakustr
• https://github.com/CodyTseng/nostr-relay-nestjs
• https://github.com/CodyTseng/nostr-relay
• https://github.com/CodyTseng

阿甘

• @agan0
• 0xchat.com
• canidae40@coinos.io
• https://jumble.social/users/npub13zyg3zysfylqc6nwfgj2uvce5rtlck2u50vwtjhpn92wzyusprfsdl2rce

joomaen

• Follows you
• joomaen.com

• 95aebd@wallet.yakihonne.com

• nobot

• https://joomaen.filegear-sg.me/
• https://jumble.social/users/npub1wlpfd84ymdx2rpvnqht7h2lkq5lazvkaejywrvtchlvn3geulfgqp74qq0

颜值精选官

• wasp@ok0.org
• 专注分享 各类 图片与视频，每日为你带来颜值盛宴，心动不止一点点。欢迎关注，一起发现更多美好！
• https://jumble.social/users/npub1d5ygkef6r0l7w29ek9l9c7hulsvdshms2qh74jp5qpfyad4g6h5s4ap6lz

6svjszwk

• 6svjszwk@ok0.org
• 83vEfErLivtS9to39i73ETeaPkCF5ejQFbExoM5Vc2FDLqSE5Ah6NbqN6JaWPQbMeJh2muDiHPEDjboCVFYkHk4dHitivVi

• low-time-preference

• anarcho-capitalism

• libertarianism

• bitcoin #monero

• https://jumble.social/users/npub1sxgnpqfyd5vjexj4j5tsgfc826ezyz2ywze3w8jchd0rcshw3k6svjszwk

𝘌𝘷𝘦𝘳𝘺𝘥𝘢𝘺 𝘔𝘰𝘳𝘯𝘪𝘯𝘨 𝘚𝘵𝘢𝘳

• everyday@iris.to
• 虽然现在对某些事情下结论还为时尚早，但是从趋势来看，邪恶抬头已经不可避免。
• 我们要做的就是坚持内心的那一份良知，与邪恶战斗到底。
• 黑暗森林时代，当好小透明。
• bc1q7tuckqhkwf4vgc64rsy3rxy5qy6pmdrgxewcww
• https://jumble.social/users/npub1j2pha2chpr0qsmj2f6w783200upa7dvqnnard7vn9l8tv86m7twqszmnke

nostr_cn_dev

npub1l5r02s4udsr28xypsyx7j9lxchf80ha4z6y6269d0da9frtd2nxsvum9jm@npub.cash

Developed the following products: - NostrBridge, 网桥转发 - TaskQ5, 分布式多任务 - NostrHTTP, nostr to http - Postr, 匿名交友，匿名邮局 - nostrclient (Python client) . -nostrbook, (nostrbook.com) 用nostr在线写书 * https://www.duozhutuan.com nostrhttp demo * https://github.com/duozhutuan/NostrBridge * * https://jumble.social/users/npub1l5r02s4udsr28xypsyx7j9lxchf80ha4z6y6269d0da9frtd2nxsvum9jm *

CXPLAY

• lightning@cxplay.org
• 😉很高兴遇到你, 你可以叫我 CX 或 CXPLAY, 这个名字没有特殊含义, 无需在意.
• ©本账号下所有内容如未经特殊声明均使用 CC BY-NC-SA 4.0 许可协议授权.
• 🌐如果您在 Fediverse 收到本账号的内容则说明您的实例已与 Mostr.pub 或 Momostr.pink Bridge 互联, 您所看到的账号为镜像, 所有账号内容正在跨网传递. 如有必要请检查原始页面.
• 🧑‍💻正在提供中文本地化(i10n): #Amethyst #Amber #Citrine #Soapbox #Ditto #Alby
• https://cx.ms/

https://jumble.social/users/npub1gd8e0xfkylc7v8c5a6hkpj4gelwwcy99jt90lqjseqjj2t253s2s6ch58h

w

• 0xchat的作者
• 0xchat@getalby.com
• Building for 0xchat
• https://www.0xchat.com/
• https://jumble.social/users/npub10td4yrp6cl9kmjp9x5yd7r8pm96a5j07lk5mtj2kw39qf8frpt8qm9x2wl

Michael

• highman@blink.sv
• Composer Artist | Musician
• 🎹🎼🎤🏸🏝️🐕❤️
• 在這裡可以看到「我看世界」的樣子
• 他是光良
• https://jumble.social/users/npub1kr5vqlelt8l47s2z0l47z4myqg897m04vrnaqks3emwryca3al7sv83ry3

@ 06b7819d:d1d8327c

Hanlon’s Razor is a philosophical principle or adage that states:

“Never attribute to malice that which is adequately explained by stupidity.”

It suggests that when trying to understand someone’s actions, it is often more reasonable to assume a lack of knowledge, competence, or foresight rather than intentional harm or ill will. The principle encourages people to avoid jumping to conclusions about malicious intent and instead consider simpler, more mundane explanations.

Hanlon’s Razor is often used in problem-solving, interpersonal interactions, and organizational settings to promote understanding and reduce conflict. It’s part of a broader family of “razors,” which are rules of thumb used to simplify decision-making.

@ 592295cf:413a0db9

Nostur is capable of login with bunker

Photo, note by Fabian

nostr:nevent1qvzqqqqqqypzqkfzjh8jkzd8l9247sadku6vhm52snhgjtknlyeku6sfkeqn5rdeqyf8wumn8ghj7mn0wd68ytnvw5hxkef0qyg8wumn8ghj7mn0wd68ytnddakj7qpqxfktwlm2qdkpxy556e4yg4l8p6v8930nfyzg7p3vsknk7krutz0s8znjtq

---

When you decide to share an app you have to know a lot about that app. For example the nstart feature that you can share your friends, has a "smart pack" and the app can onboard, at least following the link --> Apps-integration

So let's try to read and bring a bit to the summary of the thing. Only the one about the profiles, which you don't know exactly how it will end, you have to try it before sending to someone. the second point is that it says that there is no "support encryption, so it cannot be used for DMs apps".

there was an update of nstart, now it shows you

the names of the bunkers, maybe now it's too much, decide if it does 3/2 4/2 or just automatic.

So they talked about frost in the hodlbod podcast. I didn't understand much except that they said to test frost and report the feedback. Tomorrow I'll try to download igloo and frost+nos2ex

So I have to wait for let's say version 0_1_0 of igloo now it is (0_0_4) and

maybe there will be the version of the extension ready.

Sebastix also found it difficult but I think he was trying to install the server, which didn't even occur to me. Anyway I leave you the note if you want to go deeper...

nostr:nevent1qvzqqqqqqypzqpnrnguxe8qszsshvgkvhn6qjzxy7xsvx03rlrtddr62haj4lrm3qytkummnw3ez66tyvgaz7tmrv93ksefdwfjkccteqqs2wzkkx220e24revkpxmdzkqj73rnz0reeenjwgy53g36hlkdgurgrs5e62

Let's see if I can download the video. ok Downloaded. Video .mov

If you don't want to watch I'll leave a little description

1 Download and install igloo, from the frost page. 2 Create a new key set, you can generate or copy an existing key. 3. Choose the options for the key and now they become multiple keys 4. Created a group of credentials. 5. Save the two credentials with a password and bring the third into the browser extension that it creates from the repository, it says that there will be a bootable extension for chrome. 6. Copy the third key and the group package key into the application node. 7. Once you have entered these keys you can finish the operation (and you have backed up the other two) in igloo. 8. When it goes forward it finds itself with two keys, both encrypted with passwords. 9. Since it is a three of two, it just needs to activate a key in igloo and it starts communicating "startsigner". 10. Opens a nostr client and connects with frost2sx and writes a note 11. Shows the log, and says that if you enter two keys it can generate a third, invalidating the old one (I assume)

@ 2b24a1fa:17750f64

Wer sein eigenes Geld abheben möchte, macht sich heute – in Spanien - verdächtig. Wer dort eine größere Geldmenge des eigenen Vermögens abzuheben gedenkt, muss das von nun an Tage zuvor anmelden. Diese neue Regelung lässt sich auch nicht dadurch umgehen, dass man mehrere kleine Einzelbeiträge abhebt. Und die, die die neue Regelung missachten, werden empfindlich bestraft. So gerät jeder, der zu häufig Bares abhebt, in das Visier der Behörden.

https://soundcloud.com/radiomuenchen/barzahler-unter-generalverdacht-von-norbert-haring?

Was sich in Spanien an Bankautomaten und -schaltern eingeschlichen hat, könnte sich seinen Weg auch nach Deutschland bahnen. In Frankreich, so zeigt die persönliche Erfahrung, variiert die zu erzielende Geldmenge am Automaten unter noch ungeklärten Bedingungen von Tag zu Tag, von Konto zu Konto. Der Automat gibt vor, ob gerade beispielsweise 60, 200 oder 400 Euro abgehoben werden dürfen.

Hören Sie Norbert Härings Text zum spanischen Szenario der den Titel „Barzahler unter Generalverdacht“ trägt und zunächst auf seinem Blog erschienen war. norberthaering.de/news/spanien-bargeld/

Sprecher: Karsten Troyke

@ b99efe77:f3de3616

🚦Traffic Light Control System🚦

This Petri net represents a traffic control protocol ensuring that two traffic lights alternate safely and are never both green at the same time.

petrinet ;start () -> greenLight1 redLight2 ;toRed1 greenLight1 -> queue redLight1 ;toGreen2 redLight2 queue -> greenLight2 ;toGreen1 queue redLight1 -> greenLight1 ;toRed2 greenLight2 -> redLight2 queue ;stop redLight1 queue redLight2 -> ()

@ b8af284d:f82c91dd

Vor genau 40 Jahren, unter den Kronleuchtern eines New Yorker Ballsaals, wurde das berüchtigte ‚Plaza Accord‘ unterzeichnet, das eine Finanztsunami auslöste, der den japanischen Yen in nur 16 Monaten um 46 Prozent in die Höhe trieb. Die Exporte brachen ein, und Japans beeindruckendes Wirtschaftswachstum von 5 Prozent schrumpfte zu Staub.“

Xi Jinping am 26. April 2025

Liebe Abonnenten,

2010 kam es zu einer mysteriösen Serie von Selbstmorden in der chinesischen Stadt Shenzhen. Insgesamt nahmen sich zwischen Januar und August 13 Menschen das Leben, in dem sie von Hochhäusern sprangen. Die chinesischen Medien berichteten stets über Einzelfälle. Erst ausländischen Korrespondenten gelang es, die Selbstmorde miteinander in Verbindung zu setzen: Alle waren Angestellte des Apple-Zulieferers Foxconn. Alle waren sogenannte Wanderarbeiter aus den umliegenden Provinzen. Ihr monatliches Gehalt von umgerechnet 110 Euro war auch für chinesische Verhältnisse derart niedrig, dass sie sich gezwungen sahen, Überstunden zu leisten. Trotz der viel gepriesenen chinesischen Fähigkeit 吃苦 „Bitterkeit zu essen“, erschien vielen Angestellten ihr Leben so unerträglich und ausweglos, dass sie sich das Leben nahmen.

Nach einem internationalen Shitstorm reagierte Foxconn: Man erhöhte die Gehälter um 70 bis 100 Prozent und spannte Netze in der „Foxconn-City“ auf, um weitere Selbstmorde zu verhindern.

Gegründet wurde Foxconn 1974 von Terry Gou in Taiwan unter dem Namen „Hon Hai Precision Industry“. Mit der wirtschaftlichen Öffnungspolitik der Volksrepublik expandierte Gou auf das chinesische Festland, wo er Heerscharen von billigen Arbeitskräften fand. Heute beschäftigt Foxconn mehr als eine Million Menschen und fertigt rund 70 Prozent aller iPhones weltweit.

Apple-Zulieferer Foxconn steht wie kaum ein anderes Unternehmen für den wirtschaftlichen Megatrend der vergangenen Jahrzehnte. In den USA entworfene Produkte werden in Asien gefertigt und weltweit verkauft. Komplexe Lieferketten spannen sich um den gesamten Globus. Immer neue Märkte müssen erschlossen werden, um den Rendite-Erwartungen der Anleger gerecht zu werden. Die globale Produktion wandert von Land zu Land, bis die Lohnkosten so dort stark gestiegen sind, dass es Zeit wird weiterzuziehen. Nun ist ein neuer Faktor hinzugekommen: Geopolitik.

Vor wenigen Tagen gab Apple bekannt, dass es einen großen Teil seiner iPhone-Fertigung von China nach Indien verlagern werde.

Sprich: Foxconn zieht um. Der Zulieferer betreibt Werke in Tamil Nadu und Karnataka und plant eine neue Fabrik nahe Bengaluru mit Investitionen von bis zu 2,7 Milliarden US-Dollar. Dort sind zwar die Produktionskosten rund acht Prozent höher als in China, aber Apple will so sein Ziel erreichen, 2026 alle iPhones in Indien fertigen zu lassen. Punktsieg für Trump, Vance und Bessent.

---

Mehr zum Thema:

Die nächsten 90 Tage

BlingBling

·

11. Apr.

Drei Monate hat die Welt Aufschub vor amerikanischen Zöllen bekommen, 90 Tage, in denen der Handelskrieg mit China tobt. Was Trump in dieser Zeit wirklich vorhat.

Read full story

Abgekoppelt

BlingBling

·

1. Mai

In den vergangenen Wochen konnte man erleben, wie Bitcoin zum sicheren Hafen wurde. Wie nachhaltig ist die Entwicklung? Der Bling-Report April 2025

Read full story

"Sie müssen Geld drucken"

BlingBling

·

13. Apr.

Fondsmanager und Investorenlegende Marc Faber über den aktuellen Aktien-Crash, Donald Trump und Gold

Read full story

Ein Paid-Abo beinhaltet 4 bis 6 Artikel pro Monat (statt 2 bis 4), einen monatlichen Investment-Report samt Musterdepot, Zugang zu allen Artikeln sowie 4 Tutorials über Bitcoin, Gold, ETFs und Altcoins. Ein Test-Abo gibt es schon für sieben Euro im Monat. Bitcoin-Zahler erhalten 20% Rabatt!

---

Das, was im Zollkrieg zwischen den USA und China gerade stattfindet, ähnelt dem Prinzip des 2500 Jahre alten chinesischen Spiels: im Gegensatz zu Schach, wo es um das Eliminieren des gegnerischen Königs geht, ist Go subtiler. Es gibt kein direktes „Schachmatt“, sondern einen Wettstreit um Raum und Einfluss. Verbündete werden gesucht, um den jeweiligen Gegner zu entwaffnen, bevor es zu einer entscheidenden Schlacht überhaupt kommen kann.

90 Tage Aufschub hat Donald Trump allen Handelspartnern gewährt - bis auf China. Zuvor hatte er am „Liberation Day“ Zölle auf nahezu alle Ländern erhoben, mit denen die USA ein Handelsdefizit aufweisen. Ob hinter der Schaukelpolitik Kalkül steckt, oder ob ihm besonnenere Gemüter in der Regierung dazu geraten haben, nachdem der amerikanische Aktienmarkt in den Keller gerauscht war, bleibt offen für Spekulationen. Auf jeden Fall bleiben den beiden größten Volkswirtschaften der Welt nun noch etwas über zwei Monate, möglichst viele Verbündete zu finden, um den Gegner zu isolieren. „Wir können wahrscheinlich mit unseren Verbündeten einen Deal erreichen“, sagte Finanzminister Scott Bessent. „Und dann können wir gemeinsam als Gruppe auf China zugehen.“ Die USA haben an und für sich viele Argumente auf ihrer Seite:

Hinter der Paywall: Wer hat die besseren Chancen, das Spiel zu gewinnen?

@ 866e0139:6a9334e5

\ \ Autor: Marcel Bühler. Dieser Beitrag wurde mit dem Pareto-Client geschrieben. Sie finden alle Texte der Friedenstaube und weitere Texte zum Thema Frieden hier. Die neuesten Pareto-Artikel finden Sie in unserem Telegram-Kanal.

---

Die neuesten Artikel der Friedenstaube gibt es jetzt auch im eigenen Friedenstaube-Telegram-Kanal.

---

"Die Ausrufung des Notstands ist der Notstand. Er eröffnet die Möglichkeit eines Endes der Rechtsstaatlichkeit"

Prof. em. Richard K. Sherwin NY Law School

Die von Präsident Donald Trump initiierten Friedensbemühungen zur Beendigung des russisch-ukrainischen Krieges scheinen keinen Erfolg zu bringen. Während Russland darauf beharrt, dass die im Herbst 2022 offiziell in die Russische Föderation aufgenommenenRegionen Lugansk, Donezk, Saporoschje und Cherson von der ukrainischen Armee vollständig geräumt werden, will Präsident Selenskij nicht einmal auf die Krim verzichten und deren Zugehörigkeit zu Russland seit 2014 anerkennen.

Während die Ukraine Sicherheitsgarantien für die Zeit nach einem möglichen Waffenstillstand bzw. Friedensabkommen fordert, besteht Russland weiterhin auf einer weitgehenden Demilitarisierung der ukrainischen Armee und besonders ein Verbot aller ultranationalen bzw. nazistischen Einheiten welche vor allem in der ukrainischen Nationalgarde konzentriert sind.

Nur ein Rohstoffdeal zwischen Washington und Kiew ist offenbar zustande gekommen, da Trump für die vielen Milliarden Dollar, welche in den letzten Jahren in die Ukraine "investiert" wurden, eine Gegenleistung bekommen möchte (nach dem "Ukraine Democracy Defense Lend-Lease Act" vom 19.1.2022 welcher von Präsident Biden am 9.5.2022 unterzeichnet wurde).

Im Rahmen einer Armeereform ist die Ukrainische Nationalgarde auf Anfang April 2025 in 2 Armeekorps mit je fünf Brigaden aufgeteilt worden: das erste Armeekorps wird von der 12. Brigade "Asow", das zweite Armeekorps von der 13. Brigade "Chartia" angeführt welche ursprünglich aus Freiwilligenbataillonen hervorgingen. Insgesamt dürfte es sich bei den 10 Brigaden um ca. 40'000 Mann handeln. Hier eine kurze Selbstdarstellung der Nationalgarde, in der auch der Kommandant, Alexander Pivnenko, zu Wort kommt (leider nur auf ukrainisch):

https://www.youtube.com/watch?v=0fjc6QHumcY

Alexander Syrskij, der aktuelle ukrainische Oberfehlshaber, hat kürzlich den Befehl erlassen, dass die mehr als 100'000 Mann der von der Bevölkerung gefürchteten Rekrutierungstruppe "TZK" ("Територіальний центр комплектування та соціальної підтримки") nun ebenfalls als Kampftruppen an die Front müssen, da die Mobilisierung weiterer ukrainischer Männer weitgehend gescheitert sei. Gleichzeitig wird über die Senkung des Mobilisierungsalters auf 18 Jahre und ein möglicher Einzug von Frauen diskutiert (die bereits als Freiwillige mitkämpfen). 

Für die Zeit um den 9. Mai ("Tag des Sieges") hat Russland einen weiteren einseitigen Waffenstillstand ausgerufen, den die Ukrainer vermutlich wie an Ostern für Gegenangriffe an der Front oder Provokationen in Russland (z.B. Anschläge oder Drohnenangriffe in/auf Moskau nutzen werden). Über die Osterfeiertage hatten sich beide Seiten wie üblich gegenseitig beschuldigt, die verkündete Waffenruhe wiederholt gebrochen zu haben.

Die Kämpfe und die Opferung von Abertausenden dürften also bis auf weiteres weitergehen, auch wenn sie den Kriegsverlauf nicht mehr entscheidend ändern werden. Die Verlustrate beträgt aktuell ca. 1:10 zuungunsten der Ukrainer, da die Russen mittlerweile bei allen Waffensystemen überlegen sind, nicht nur bei der Artillerie und der Luftwaffe sondern auch im Bereich der Drohnen und der elektronischen Kriegsführung.

Wie es dazu kommen konnte, dass die Ukraine aus einem zwar hochkorrupten, aber relativ freien Land zu einem totalitären Militärregime wurde, zeigt ein neues Video eines jungen Ukrainers aus Mariupol, der die dortigen Kämpfe im Frühjahr 2022 im Keller überlebte und es aber vorzog, dort zu bleiben und die russische Staatsbürgerschaft anzunehmen. Aus Sicherheitsgründen nennt er seinen ukrainischen Namen nicht. Seine sachliche Darstellung ist weit davon entfernt, russische oder westliche Propaganda zu sein, sondern stellt eine nüchterne und auf persönlicher Erfahrung basierende Analyse der Ereignisse in der Ukraine seit 2014 dar.

Besonders eindrücklich zeigt er mit Filmmaterial auf, wie nach dem rechtswidrigen Putsch in Kiew, welcher von den Rechtsnationalen als "Revolution der Würde" bezeichnet wird und von Kräften aus dem Westen massiv unterstützt wurde (z.B. durch US-AID), besonders die ukrainische Jugend indoktriniert und militarisiert und auf den kommenden Krieg mit Russland vorbereitet wurde. Hier muss man unwillkürlich an die HJ (Hitler Jugend) denken, deren Schicksal am Ende des 2. WK allgemein bekannt sein dürfte. Es lohnt sich, den rund 35minütigen Beitrag zweimal anzusehen, um alles richtig zu verstehen und aufzunehmen (auf englisch mit slawischem Akzent):

https://www.youtube.com/watch?v=ba_NPxVXVyc

Den 1. Mai habe ich dieses Jahr am Stand der Schweizer Friedensbewegung im Areal der ehemaligen Stadt Zürcher Kaserne verbracht und dabei auch für den neu gegründeten Verein "Bewegung für Neutralität" (BENE) geworben. Der bekannte Friedensforscher Daniele Ganser wird diesen und nächsten Monat an den grossen Schweizer Bahnhöfen eine Plakatwerbung für die immerwährende Neutralität der Schweiz starten (siehe Entwurf im Anhang).

Zu Frieden und Völkerverständigung gibt es keine Alternative, dazu gehört auch das Studium und die Analyse des ukrainischen Nationalismus und Faschismus ("Stepan Bandera Ideologie"), dessen Ursprung und Entwicklung in den letzten rund 100 Jahren bis in die heutige Zeit.

Nur die Rüstungslobby kann mit der viel zitierten "Friedensdividende" nichts anfangen!

---

Marcel Bühler ist freier Mitarbeiter und Rechercheur aus Zürich. Dieser Beitrag erschien zuerst in seinem Newsletter.

---

LASSEN SIE DER FRIEDENSTAUBE FLÜGEL WACHSEN!

Hier können Sie die Friedenstaube abonnieren und bekommen die Artikel zugesandt.

Schon jetzt können Sie uns unterstützen:

• Für 50 CHF/EURO bekommen Sie ein Jahresabo der Friedenstaube.
• Für 120 CHF/EURO bekommen Sie ein Jahresabo und ein T-Shirt/Hoodie mit der Friedenstaube.
• Für 500 CHF/EURO werden Sie Förderer und bekommen ein lebenslanges Abo sowie ein T-Shirt/Hoodie mit der Friedenstaube.
• Ab 1000 CHF werden Sie Genossenschafter der Friedenstaube mit Stimmrecht (und bekommen lebenslanges Abo, T-Shirt/Hoodie).

Für Einzahlungen in CHF (Betreff: Friedenstaube):

Für Einzahlungen in Euro:

Milosz Matuschek

IBAN DE 53710520500000814137

BYLADEM1TST

Sparkasse Traunstein-Trostberg

Betreff: Friedenstaube

Wenn Sie auf anderem Wege beitragen wollen, schreiben Sie die Friedenstaube an: friedenstaube@pareto.space

---

Sie sind noch nicht auf Nostr and wollen die volle Erfahrung machen (liken, kommentieren etc.)? Zappen können Sie den Autor auch ohne Nostr-Profil! Erstellen Sie sich einen Account auf Start. Weitere Onboarding-Leitfäden gibt es im Pareto-Wiki.

\

@ 592295cf:413a0db9

[Edit] I tried to get the slides and an audio file, from Constant's talk at NostRiga, about 8 months ago

1.

Nostr's adoption thesis

The less you define, the more you imply

by Wouter Constant

2.

Dutch Bitcoiner

AntiHashedPodcast

Writing Book about nostr

00:40

3.

What this presentation about

A protocols design includes initself a thesis

on protocol adoption, due to underlying assumptions

1:17

4.

Examples

Governments/Academic: Pubhubs (Matrix)

Bussiness: Bluesky

Foss: Nostr

1:58

5.

What constitutes minimal viability?

Pubhubs (Matrix): make is "safe" for user

Bluesky: liability and monetization

Foss: Simpel for developer

4:03

6.

The Point of Nostr

Capture network effects through interoperability

4:43

7.

Three assumptions

The direction is workable

Method is workable

Motivation and means are sufficient

5:27

8.

Assumption 1

The asymmetric cryptography paradigm is a good idea

6:16

9.

Nostr is a exponent of the key-pair paradigm.

And Basicly just that.

6.52

10.

Keys suck

Protect a secret that you are supposed use all the time.

7:37

11.

Assumption two

The unaddressed things will be figured out within a 'meta-design consensus'

8:11

12.

Nostr's base protocol is not minimally viable for anything, except own development.

8:25

13.

Complexity leads to capture;

i.e. free and open in the name,

controlled in pratice

9:54

14.

Meta-design consensus

Buildings things 'note centric' mantains interoperability.

11:51

15.

Assumption three

the nightmare is scary;

the cream is appealing.

12:41

16.

Get it minimally viable,

for whatever target,

such that it is not a waste of time.

13:23

17.

Summarize

We are in a nightmare.

Assume key/signature are the way out.

Assume we can Maintain an open stardand while manifesting the dream.

Assume we are motivated enought to bootstrap this to adulthood.

14:01

18.

We want this,

we can do this,

because we have to.

14:12

Thank you for contribuiting

[Edit] Note for audio presentation

nostr:nevent1qvzqqqqqqypzqkfzjh8jkzd8l9247sadku6vhm52snhgjtknlyeku6sfkeqn5rdeqyf8wumn8ghj7mn0wd68ytnvw5hxkef0qyg8wumn8ghj7mn0wd68ytnddakj7qpqqqq6fdnhvp95gqf4k3vxmljh87uvjezpepyt222jl2267q857uwqz7gcke

@ 5ffb8e1b:255b6735

As a fellow Nostrich you might have noticed some of my #arlist posts. It is my effort to curate artists that are active on Nostr and make it easier for other users to find content that they are interested in.

By now I have posted six or seven posts mentioning close to fifty artists, the problem so far is that it's only a list of handles and it is up to reader to click on each in order to find out what are the artist behind the names all about. Now I am going to start creating blog posts with a few artists mentioned in each, with short descriptions of their work and an image or to.

I would love to have some more automated mode of curation but I still couldn't figure out what is a good way for it. I've looked at Listr, Primal custom feeds and Yakihonne curations but none seem to enable me to make a list of npubs that is then turned into a feed that I could publicly share for others to views. Any advice on how to achieve this is VERY welcome !

And now lets get to the first batch of artists I want to share with you.

Eugene Gorbachenko

nostr:npub1082uhnrnxu7v0gesfl78uzj3r89a8ds2gj3dvuvjnw5qlz4a7udqwrqdnd Artist from Ukrain creating amazing realistic watercolor paintings. He is very active on Nostr but is very unnoticed for some stange reason. Make sure to repost the painting that you liked the most to help other Nostr users to discover his great art.

Siritravelsketch

nostr:npub14lqzjhfvdc9psgxzznq8xys8pfq8p4fqsvtr6llyzraq90u9m8fqevhssu a a lovely lady from Thailand making architecture from all around the world spring alive in her ink skethes. Dynamic lines gives it a dreamy magical feel, sometimes supported by soft watercolor strokes takes you to a ferytale layer of reality.

BureuGewas

nostr:npub1k78qzy2s9ap4klshnu9tcmmcnr3msvvaeza94epsgptr7jce6p9sa2ggp4 a a master of the clasic oil painting. From traditional still life to modern day subjects his paintings makes you feel the textures and light of the scene more intense then reality itself.

You can see that I'm no art critic, but I am trying my best. If anyone else is interested to join me in this curration adventure feel free to reach out !

With love, Agi Choote

@ a29cfc65:484fac9c

Bei einer Führung durch den Naumburger Dom sprach der Domführer über Propaganda im Mittelalter. Die gefühlvollen Gesichtsausdrücke der steinernen Stifterfiguren rund um die berühmte Uta sollten das Volk beeinflussen. Darüber haben wir auf der Heimfahrt nach Leipzig philosophiert und fanden den Denkansatz spannend. Denn auch wenn es damals nicht Propaganda hieß, so gab es doch Interessen der Mächtigen, die sie gegenüber dem Volk durchsetzten. Sie bedienten sich dabei der damals verfügbaren „Medien“, zu denen die Kirche gehörte, wo sich das Volk zum Gottesdienst traf.

Kulturelle Identität Europas

Mitteldeutschland ist ein Zentrum mittelalterlicher Baukunst. Der Naumburger Dom St. Peter und Paul wurde auf den Grundmauern einer noch älteren Kirche im 13. Jahrhundert gebaut. Er ist weltweit einzigartig in seiner Architektur, Bildhauerkunst und Glasmalerei. Seit 2018 ist er Unesco-Weltkulturerbe. Die Stadt Naumburg hatte einst die gleiche Bedeutung wie Merseburg, Magdeburg oder Leipzig. Der Dom – von der Spätromanik bis in die Frühgotik unter Leitung eines heute unbekannten Bildhauerarchitekten errichtet – gilt als Meisterwerk menschlicher Schöpferkraft und Handwerkskunst. Die naturwissenschaftlich-physikalischen Kenntnisse der Menschen waren offensichtlich enorm. Sie verfügten über das Wissen zur Planung und über entsprechende Werk- und Hebezeuge, um solche Bauwerke in relativ kurzer Zeit errichten zu können.

Im Westchor des Doms befinden sich mit den zwölf lebensgroßen Stifterfiguren die bekanntesten Kunstwerke des Doms, unter ihnen Uta von Ballenstedt. Sie soll Walt Disney als Quelle für die schöne und sehr stolze Königin im Zeichentrickfilm Schneewittchen gedient haben. Das Besondere und Neue an den steinernen Stifterfiguren war ihre realitätsnahe Darstellung, die sie lebendig und ausdrucksstark wirken lässt. Sie sind ein Höhepunkt in der Steinmetzkunst der damaligen Zeit. Die Figuren wurden, obschon die dargestellten Personen bereits mehr als 200 Jahre tot waren, mit charakteristischen Gesichtsausdrücken dargestellt: Uta schaut schön und stolz in die Ferne, ihr Gatte Ekkehard wirkt etwas hochmütig. Gegenüber steht die lachende Reglindis neben ihrem wehmütig-leidend blickenden Mann Hermann von Meißen.

Der Domführer sagte, dass die Gesichtsausdrücke menschliche Verhaltensweisen darstellen, die bei den Kirchenbesuchern unerwünscht waren. Wir hätten es hier mit einer sehr frühen Form der Propaganda zu tun. Die katholische Kirche war Vorreiter in Sachen Propaganda. Sie hat etwa 400 Jahre später, im Jahr 1622, mit der Sacra Congregatio de Propaganda Fide ein Amt gegründet, das den „richtigen“ Glauben in die Welt tragen sollte, und erst 1967 umbenannt wurde. Aber ihre gesellschaftlich führende Position hatte damals auch eine positive Seite: Den Kirchen und Klöstern haben wir den Erhalt und die Weitergabe antiken Wissens zu verdanken. Europa konnte sich trotz der politischen Zersplitterung seine kulturelle Identität erhalten. Zum Beispiel lässt sich das Wirken des namenlosen Domschöpfers anhand der Bau- und Kunstwerke quer durch Europa von Nordfrankreich über Mainz nach Naumburg und Meißen nachvollziehen. Aus der weiteren Entwicklung von Kunst und Kultur in Europa entstand in der Renaissance die Philosophie des Humanismus und später daraus die Aufklärung mit ihrer Wirkung auf Literatur und Wissenschaft. Ziel war dabei immer eine Stärkung des Gemeinwesens.

Transhumanismus zerstört Gemeinschaften

Heute scheinen wir uns allerdings an einer Bruchstelle der gesellschaftlichen Entwicklung zu befinden. Die Kirchen spielen in unserer Gesellschaft kaum noch eine Rolle. Weder bringen sie sich in ethische Diskussionen hörbar ein, noch tragen sie die Entwicklung von Kunst und Kultur sichtbar voran. Ihre Rolle im Bereich Propaganda haben längst Zeitungen und Zeitschriften, Rundfunk und Fernsehen übernommen. Diese Medien haben eine größere Reichweite, und die psychologische Beeinflussung ist umfassender. Nach dem Zweiten Weltkrieg wurde die Manipulation der Massen stark intensiviert und nahm nach dem Zusammenbruch der Sowjetunion noch weiter an Fahrt auf. Der Liberalismus konnte auf allen Gebieten seinen Siegeszug antreten, stellte das Individuum in den Mittelpunkt und erhob den Markt zur heiligen Kuh. Im Laufe der Zeit wurden die humanistischen Ideen der Aufklärung in ihr Gegenteil verkehrt. Der Mensch wurde als fehlerhaftes Wesen identifiziert, in die Vereinzelung getrieben, bevormundet und gegängelt – angeblich, damit er sich nicht selbst schadet. Zur psychologischen Beeinflussung kommen die neuen technischen Möglichkeiten aus Bio-Nano-Neuro-Wissenschaften und Digitalisierung. Der Transhumanismus wurde als neues Ziel für die Menschheit ausgerufen. Der Einzelne soll biologisch und technisch perfektioniert werden. Gemeinschaften – von der Familie angefangen – treibt das in die Bedeutungslosigkeit. Es besteht die Gefahr, dass persönliche Integrität und Privatsphäre durch Eingriffe in Körper- und Geistesfunktionen verletzt werden. Eine neue Aufklärung ist nötig. Denn sehr viel von dem über die Jahrhunderte erlangten Wissen ging schon verloren oder ist nur noch versteckt in den Bibliotheken und Archiven der Kirchen zu finden. Die Besinnung auf die vergessenen beziehungsweise verdrängten Grundlagen und Ideale der Aufklärung kann diese Entwicklung abwenden. Die Kulturschätze Mitteleuropas vermitteln in ihrer Schönheit und Vollkommenheit die Ruhe und die zeitlichen und räumlichen Dimensionen, die wir brauchen, wenn wir über die Frage nachdenken, wie wir in Zukunft leben wollen.

Die Rolle der neuen Medien für die zukünftige Entwicklung

Von den Alt-Medien ist in dieser Hinsicht nichts zu erwarten. Sie werden finanziert und sind unterwandert von den Kräften, die transhumanistische Entwicklungen vorantreiben. Die „neue Aufklärung“ ist ein lohnenswertes Ziel für die neuen Medien. Diese lassen sich jedoch noch zu sehr von den aktuellen Themen der Alt-Medien treiben. Der Angst-Propaganda begegnen sie mit – Ängsten, wenn auch anders ausgerichtet. Einige reiten die Empörungswelle in Gegenrichtung zu den Alt-Medien. Manche Betreiber von „alternativen“ Finanz- und Wirtschaftskanälen wollen ihre eigenen marktgläubigen Produkte an den Mann bringen. Stattdessen sollten in den neuen Medien positive Nachrichten verbreitet und eigene Themenfelder eröffnet werden, denen sich die Alt-Medien verweigern:

· der Mensch und seine Bildung zur souveränen, selbständig denkenden und handelnden Persönlichkeit,

· die Entwicklung des eigenen Bewusstseins, um der Fremdbestimmung zu entkommen und zu Wahrhaftigkeit, Authentizität und Menschlichkeit zu gelangen,

· die Entwicklung des Gemeinwohls,

· die Frage, wie wir neue Gemeinschaften bis hin zu autarken Gemeinden gründen können – wichtiger, je mehr das gesellschaftliche System um uns herum zusammenbricht.

Direkt sichtbar ist der letzte Punkt am Niedergang der Architektur und am Zustand der Innenstädte: Die reich dekorierten Gebäude der Gründerzeit wurden nach ihrer Zerstörung im Zweiten Weltkrieg durch gleichförmig rechteckige Gebäude aus Beton und Glas ersetzt. Dazu kamen die in allen Städten austauschbar gleichen Ladenzeilen und in den letzten Jahren Dreck und Schmierereien, die nicht mehr weggeräumt werden.

Die gesellschaftlichen Verwerfungen der Corona-Zeit führten bei vielen Menschen zum Innehalten und Nachdenken über Sinn und Ziele ihres Lebens. So entstanden einige Pilotprojekte, zum Beispiel in den Bereichen Landwirtschaft, Gesundheitswesen und Bildung. Diese auf die Zukunft gerichteten Themen könnten in den neuen Medien umfangreicher vorgestellt und diskutiert werden. Manova setzt schon solche Schwerpunkte mit „The Great WeSet“ von Walter van Rossum sowie mit den Kategorien „Zukunft & Neue Wege“ sowie „Aufwind“. Der Kontrafunk hat Formate entwickelt, die das Gemeinwohl stärker in den Fokus setzen wie etwa die Kultur- und Wissenschaftsrubrik. Nuoviso hat einen eigenen Songcontest ins Leben gerufen. Neben der inhaltlichen Ausrichtung auf eine lebenswerte Zukunft gilt es auch, die technologische Basis der neuen Medien zukunftsfest zu machen und sich der digitalen Zensur zu entziehen. Milosz Matuschek geht mit dem Pareto-Projekt neue Wege. Es könnte zur unzensierbaren Plattform der neuen Medien werden. Denn wie er sagt: Man baut sein neues Haus doch auch nicht auf dem Boden, der einem anderen gehört.

@ 318ebaba:9a262eae

When connecting to multiple relays in the Nostr protocol, users may encounter several challenges that can affect their overall experience. Here are some of the key issues:

Challenges of Connecting to Multiple Relays

• Performance Issues: The lightweight design of Nostr relays can lead to performance bottlenecks, especially when many users are connected simultaneously. This can result in slow message delivery or even failures in posting messages if the relays are overwhelmed[1][2][32].

• Reliability and Connectivity: Users may experience connectivity problems with certain relays, which can lead to inconsistent access to messages or delays in communication. If a relay goes offline or has connectivity issues, it can disrupt the flow of information, making it difficult for users to send or receive messages reliably[3][4][18].

• Data Synchronization: As users connect to multiple relays, ensuring that data is synchronized across these relays can be challenging. Inconsistent data states may arise if different relays store messages differently or if there are delays in message propagation. This can lead to confusion about which messages have been sent or received[7][41].

• Configuration Complexity: Managing connections to multiple relays requires a certain level of technical knowledge. Users need to configure their clients properly to connect to various relays, which can be daunting for those less familiar with the technology. Misconfigurations can lead to connection failures or suboptimal performance[4][21].

• Spam and Quality Control: With the open nature of Nostr, some relays may be more susceptible to spam or low-quality content. Users connecting to multiple relays might encounter a higher volume of irrelevant or unwanted messages, which can detract from the overall user experience[6][32].

• Security Concerns: When using multiple relays, users must be cautious about the security of their connections. Not all relays may implement the same level of security, and connecting to less secure relays could expose users to risks such as data interception or unauthorized access to their messages[26][27].

In summary, while connecting to multiple relays in Nostr offers benefits such as redundancy and improved access to information, users must navigate various challenges related to performance, reliability, configuration, and security. Addressing these issues is crucial for a smooth and effective experience on the Nostr network.

[1] https://forum.dfinity.org/t/introducing-replicatr-enhancing-nostr-with-internet-computer-integration/31861 [2] https://medium.com/coinmonks/a-deep-dive-into-nostr-clients-with-technical-insights-and-code-snippets-b1666bb11fac [3] https://nostr.com/nevent1qqsfvjvg73wxdn7mda28m704r2zv9lnzlcdgh8r0g52lfvy2wj7uw4czyq32rylmsmre84lhxdypy6jlu4dt3fxfwkq9a0p0lqdl9y8hsp0hur4fuw4 [4] https://www.reddit.com/r/nostr/comments/1e6nm68/new_nostream_relay_created_problems_with_publish/ [5] https://www.lynalden.com/the-power-of-nostr/ [6] https://bitcoinmagazine.com/technical/how-nostr-can-improve-bitcoin-privacy [7] https://barelybuggy.blog/2024/11/26/mostr-offline/ [8] https://github.com/scsibug/nostr-rs-relay/issues/126 [9] https://community.umbrel.com/t/nostr-relay-troubleshooting/17828 [10] https://research.dorahacks.io/2024/04/30/nostr-relay-incentive/ [11] https://community.start9.com/t/issue-confirming-nostr-relay/1682 [12] https://arxiv.org/html/2402.05709v1 [13] https://community.umbrel.com/t/nostr-relay-not-connecting/11401 [14] https://www.purplerelay.com/troubleshooting-common-issues-with-nostr-relay-server-a-users-guide/ [15] https://news.ycombinator.com/item?id=35694029 [16] https://substack.com/home/post/p-158872714?utm_campaign=post&utm_medium=web [17] https://stacker.news/items/142013 [18] https://www.reddit.com/r/nostr/comments/1h6admk/are_these_relays_working/ [19] https://news.ycombinator.com/item?id=33746360 [20] https://github.com/scsibug/nostr-rs-relay/issues/195 [21] https://www.purplerelay.com/how-to-run-a-nostr-relay-a-step-by-step-guide/ [22] https://denostr.medium.com/the-future-of-social-communication-nostrs-origins-and-the-next-destination-in-social-networking-27f0c901d7ae [23] https://nostr.com/nevent1qqsqwklh29cvf3z0skhh77xyqf3m53xkppcttf3c8nuc2jqteulfx0czyqcgr7epv9hha2v9afp99l5wl0ljna0zum59fzyhl9v8pgv5xlhf5ava642 [24] https://www.reddit.com/r/nostr/comments/15fyr6r/pervasive_private_key_sharing_seems_dangerous/ [25] https://whtwnd.com/agoracitizen.network/3l2fysaripd2q [26] https://ron.stoner.com/nostr_Security_and_Privacy/ [27] https://forums.puri.sm/t/about-what-is-nostr/20764 [28] https://github.com/nostr-protocol/nips/issues/107 [29] https://medium.com/@volodymyrpavlyshyn/security-features-of-nostr-a0276a22e815 [30] https://nostr.com/nevent1qqspd8fh3tplxtfhjpka3y3glzh63v3ygsdhacyq8dvyrnxtvl09lpczyr2v7dprke9lad2qk0svug55vxguqv7n3dwn9vm63u8n5n84znxjxedjf6c [31] https://nostr.com/nevent1qqs8e2su6n8m2xtg45qdjw7rdcq6w3g5guvt085h52qhg25wxn755sczyrh26kg89z95jqaz4xkex7kaw2t36twtc75vmrfx2k3p3jqvhfa8vzan82f [32] https://www.cointribune.com/en/nostr-et-la-censure-pourquoi-un-reseau-social-decentralise-est-essentiel-2/ [33] https://nostr.com/nevent1qqsv86d756zcw32x0zcvqmr924y5sltvwqud0dywny83ndee30zzrmczyrh26kg89z95jqaz4xkex7kaw2t36twtc75vmrfx2k3p3jqvhfa8vwpfv29 [34] https://github.com/nbd-wtf/nostr-tools/issues [35] https://www.voltage.cloud/blog/the-growth-of-nostr-the-era-of-decentralization [36] https://medium.com/@BingVentures/status-quo-challenges-and-prospect-of-decentralized-social-networks-18f9584f2e8d [37] https://www.reddit.com/r/RedditAlternatives/comments/14s8ao4/greetings_im_here_to_tell_you_about_nostr_a/ [38] https://bitcoinmagazine.com/culture/nostr-the-importance-of-censorship-resistant-communication-for-innovation-and-human-progress- [39] https://github.com/mayneyao/eidos/issues/129 [40] https://www.reddit.com/r/nostr/comments/115a8et/data_duplication_and_distribution_in_nostr_relays/ [41] https://github.com/open-nostr/nostar [42] https://nostr.com/nevent1qqsryg8zuc9rdwldat385al24mdt56wanc6g6hfymy8l9tgtmzsc4nspzemhxue69uhhyetvv9ujuurjd9kkzmpwdejhg85cx73 [43] https://ckbcn.xlog.app/Nostr-sheng-tai-fa-zhan-xian-zhuang-ji-wen-ti?locale=en [44] https://nostr.com/naddr1qqc92mnvda3kk6twvuk5ummnw3ez6ued2phhgetww35kzmpdwa5hg6pdfehhgetyv43kktt08p5hscnkqgsr7acdvhf6we9fch94qwhpy0nza36e3tgrtkpku25ppuu80f69kfqrqsqqqa28aknkml

@ 592295cf:413a0db9

The journey starts from the links in this article nostr-quick-start-guide

Starting from these links building a simple path should not cover everything, because impossible.

Today I saw that Verbiricha in his workshop on his channel used nstart, but then I distracted And I didn't see how he did it.

---

Go to nstart.me and read: Each user is identified by a cryptographic keypair Public key, Private key (is a lot of stuff)

You can insert a nickname and go, the nickname is not unique

there is a email backup things interesting, but a little boring, i try to generate an email

doesn't even require a strong password ok.

I received the email, great, it shows me the nsec encrypted in clear,

Send a copy of the file with a password, which contains the password encrypted key I know and I know it's a tongue dump.

Multi signer bunker

That's stuff, let's see what he says.

They live the private key and send it to servers and you can recompose it to login at a site of the protocol nostr. If one of these servers goes offline you have the private key that you downloaded first and then reactivate a bunker. All very complicated. But if one of the servers goes offline, how can I remake the split? Maybe he's still testing.

Nobody tells you where these bunkers are.

Okay I have a string that is my bunker (buker://), I downloaded it, easy no, now will tell me which client accepts the bunker.. .

Follow someone before you start?

Is a cluster of 5 people Snowden, Micheal Dilger, jb55, Fiatjaf, Dianele.

I choice Snowden profile, or you can select multiple profiles, extra wild.

Now select 5 clients

Coracle, Chachi, Olas, Nostur, Jumble

The first is Coracle

Login, ok I try to post a note and signing your note the spin does not end.

Maybe the bunker is diffective.

Let's try Chachi

Simpler than Coracle, it has a type login that says bunker. see if I can post

It worked, cool, I managed to post in a group.

Olas is an app but also a website, but on the website requires an extension, which I do not have with this account.

If I download an app how do I pass the bunker on the phone, is it still a password, a qrcode, a qrcode + password, something like that, but many start from the phone so maybe it's easy for them. I try to download it and see if it allows me to connect with a bunker.

Okay I used private-qrcode and it worked, I couldn't do it directly from Olas because it didn't have permissions and the qrcode was < encrypted, so I went to the same site and had the bunker copied and glued on Olas

Ok then I saw that there was the qrcode image of the bunker for apps lol moment

Ok, I liked it, I can say it's a victory.

Looks like none of Snowden's followers are Olas's lover, maybe the smart pack has to predict a photographer or something like that.

Okay I managed to post on Olas, so it works, Expiration time is broken.

As for Nostur, I don't have an ios device so I'm going to another one.

Login with Jumble, it works is a web app

I took almost an hour to do the whole route.

But this was just one link there are two more

Extensions nostr NIP-07

The true path is nip-07-browser-extensions | nostr.net

There are 19 links, maybe there are too many?

I mention the most famous, or active at the moment

1. Aka-profiles: Aka-profiles

Alby I don't know if it's a route to recommend

1. Blockcore Blockcore wallet

2. Nos2x Nos2x

3. Nos2xfox (fork for firefox) Nos2xfox

Nostore is (archived, read-only)

1. Nostrame Nostrame

2. Nowser per IOS Nowser

3. One key (was tricky) One key

Another half hour to search all sites

Nostrapps

Here you can make paths

Then nstart selects Coracle, Chachi, Olas,Nostur and Jumble

Good apps might be Amethyst, 0xchat, Yakihonne, Primal, Damus

for IOS maybe: Primal, Olas, Damus, Nostur, Nos-Social, Nostrmo

On the site there are some categories, I select some with the respective apps

Let's see the categories

Go to Nostrapps and read:

Microbbloging: Primal

Streaming: Zap stream

Blogging: Yakihonne

Group chat: Chachi

Community: Flotilla

Tools: Form *

Discovery: Zapstore (even if it is not in this catrgory)

Direct Message: 0xchat

@ e83b66a8:b0526c2b

The founder of Telegram has just been arrested in France. Charges include lack of cooperation with law enforcement, drug trafficking and fraud.

Aside from Telegram, social media is controlled by two billionaires who decide what you say, are themselves controlled by overbearing governments and make money through advertising and selling your personal data.

There is a different way.

NOSTR stands for Notes and Other Stuff Transmitted on Relays and it is a social media protocol in the same way http is a web protocol.

The protocol is open and anybody can build upon it. It has some fundamental concepts that are very different to existing social media platforms.

Firstly it is decentralised, it runs across relays and anybody can run a relay. They can be open or closed, public or private, free or paid.

Secondly as a user, you don’t have an account, you have a private key which is used to secure your data.

Your profile (account) is yours, you own and control it using your private keys and verified by others with your public key.

Your posts are yours and you can store them on your own relay in your own home or business or you can rely on free public relays or more feature rich paid public relays.

All your public data is signed by your private keys to verify it is you that owns it and all your private data is encrypted so nobody can read it.

Messages (i.e. think NOSTR WhatsApp) are encrypted with your private keys so NOBODY can hack it or listen in, not even the NSA through a companies backdoor. You message other users privately by encrypting messages to them using their public key, which they decrypt using their private key.

Relays store your data in a decentralised network of private and public relays and you discover relays automatically when searching for people or content.

Data is normally sent on the clearnet, but can be relayed across the darknet (Tor) in highly censored regions.

Because it is built using Bitcoin principles and technology, so it has Bitcoin money built in, meaning you actually send / receive money from / to any participant.

As money is built in, the commercial options are different to centralised corporate owned platforms. It would be technically possible to build a platform that supports advertising, however that hasn’t really happened because influencers can be paid directly from their audience in many different ways. Ad hoc tips, subscriptions, pay to view or pay per time models.

The great thing for content creators is that they control, own and keep all the money they make. There is no third party intermediary or merchant deciding whether they are allowed to be paid or not.

NOSTR is censorship resistant, as there is no way to stop anybody publishing anything they want, in the same way nobody can stop or interfere with a Bitcoin payment.

From an end users point of view, if they want to self censor, they can do this in multiple ways. You can mute users individually, or you can choose to use relays that adhere to your views or interests, so if you don’t want to see certain categories of content, you would avoid relays that carry those feeds. You can even run your own relay and curate content that you then charge other like minded users to connect to. You can of course connect to multiple relays for multiple different type of feed.

While NOSTR is a protocol, platforms have to be built to use it, so the first platforms were twitter like clients and they are still very prevalent. However, NOSTR now has clients that emulate most social media platforms, Instagram, Facebook, YouTube, Soundcloud, WhatsApp etc. They are even creating their own categories as well as emulating other functions such as Office Suite tools, collaborative calendars, contact lists or e-commerce shops.

If you want to give it a go, the easiest, but not the best, way to get started is download Primal on your phone from here:

https://primal.net/downloads

It will create a private key for you and setup a Bitcoin wallet.

Once you have done this you can visit me here:

nostr:npub1aqakd28d95muqlg6h6nwrvqq5925n354prayckr424k49vzjds4s0c237n

If you want to see a small part of the ecosystem, then visit https://www.nostrapps.com/ where volunteers are listing some of the many apps that exist already.

NOSTR is being backed by Jack Dorsey, Twitter founder, and you can see his account here:

nostr:npub1sg6plzptd64u62a878hep2kev88swjh3tw00gjsfl8f237lmu63q0uf63m

Or you can see his account like this:

https://primal.net/jack

Edward Snowden is also on the platform and you can find him here:

https://primal.net/Snowden

NOSTR has around 2 million users or public keys, although nobody really knows how many, because it is decentralised and not controlled or run by any person or organisation.

Once you’ve setup Primal, you can use those same private keys to access any platform you wish and you can use a browser extension such as Alby to manage your keys: https://getalby.com/

Primal looks great, but there are other better functioning twitter like clients, probably the most reliable for iPhone is Damus: https://www.nostrapps.com/apps/damus

or Amethyst for Android: https://nostrapps.com/amethyst

The content and user base is very Bitcoin and freedom focused right now, but more and more people are starting to use the various platforms and some are transferring exclusively to it.

Some of the more interesting projects right now are:

https://www.0xchat.com/#/ – Private messaging – think WhatsApp

https://zap.stream/ – Video streaming

https://fountain.fm/ – Podcasting

https://wavlake.com/ – Music streaming

https://shopstr.store/ – Online shop

https://npub.pro/ – Website creation tool

https://nostr.build/ – Media and file storage

https://relay.tools/ – Build and curate your own relay

https://creatr.nostr.wine/subscriptions/new-user – Creator tools

Remember, the same keys you created for Primal can be used across the whole ecosystem.

If you want to see some of the other apps that have been built on the NOSTR protocol visit: https://nostrapps.com/

@ b99efe77:f3de3616

🚦Traffic Light Control System🚦

This Petri net represents a traffic control protocol ensuring that two traffic lights alternate safely and are never both green at the same time.

petrinet ;start () -> greenLight1 redLight2 ;toRed1 greenLight1 -> queue redLight1 ;toGreen2 redLight2 queue -> greenLight2 ;toGreen1 queue redLight1 -> greenLight1 ;toRed2 greenLight2 -> redLight2 queue ;stop redLight1 queue redLight2 -> ()

@ b99efe77:f3de3616

🚦Traffic Light Control System🚦

This Petri net represents a traffic control protocol ensuring that two traffic lights alternate safely and are never both green at the same time.

petrinet ;start () -> greenLight1 redLight2 ;toRed1 greenLight1 -> queue redLight1 ;toGreen2 redLight2 queue -> greenLight2 ;toGreen1 queue redLight1 -> greenLight1 ;toRed2 greenLight2 -> redLight2 queue ;stop redLight1 queue redLight2 -> ()

@ 2b24a1fa:17750f64

https://soundcloud.com/radiomuenchen/helge-buttkereit-medienkritik-als-trotziger-idealismus-teil-2?

@ 2dd9250b:6e928072

Vi recentemente um post onde a pessoa diz que aquele final do filme O Doutrinador (2019) não faz sentido porque mesmo o protagonista explodindo o Palácio dos Três Poderes, não acaba com a corrupção no Brasil.

Progressistas não sabem ler e não conseguem interpretar textos corretamente. O final de Doutrinador não tem a ver com isso, tem a ver com a relação entre o Herói e a sua Cidade.

Nas histórias em quadrinhos há uma ligação entre a cidade e o Super-Herói. Gotham City por exemplo, cria o Batman. Isso é mostrado em The Batman (2022) e em Batman: Cavaleiro das Trevas, quando aquele garoto no final, diz para o Batman não fugir, porque ele queria ver o Batman de novo. E o Comissário Gordon diz que o "Batman é o que a cidade de Gotham precisa."

Batman: Cavaleiro das Trevas Ressurge mostra a cidade de Gotham sendo tomada pela corrupção e pela ideologia do Bane. A Cidade vai definhando em imoralidade e o Bruce, ao olhar da prisão a cidade sendo destruída, decide que o Batman precisa voltar porque se Gotham for destruída, o Batman é destruído junto. E isso o da forças para consegue fugir daquele poço e voltar para salvar Gotham.

Isso também é mostrado em Demolidor. Na série Demolidor o Matt Murdock sempre fala que precisa defender a cidade Cozinha do Inferno; que o Fisk não vai dominar a cidade e fazer o que ele quiser nela. Inclusive na terceira temporada isso fica mais evidente na luta final na mansão do Fisk, onde Matt grita que agora a cidade toda vai saber o que ele fez; a cidade vai ver o mal que ele é para Hell's Kitchen, porque a gente sabe que o Fisk fez de tudo para a imagem do Demolidor entrar e descrédito perante os cidadãos, então o que acontece no final do filme O Doutrinador não significa que ele está acabando com a corrupção quando explode o Congresso, ele está praticamente interrompendo o ciclo do sistema, colocando uma falha em sua engrenagem.

Quando você ouve falar de Brasília, você pensa na corrupção dos políticos, onde a farra acontece,, onde corruptos desviam dinheiro arrecadado dos impostos, impostos estes que são centralizados na União. Então quando você ouve falarem de Brasília, sempre pensa que o pessoal que mora lá, mora junto com tudo de podre que acontece no Brasil.

Logo quando o Doutrinador explode tudo ali, ele está basicamente destruindo o mecanismo que suja Brasília. Ele está fazendo isso naquela cidade. Porque o símbolo da cidade é justamente esse, a farsa de que naquele lugar o povo será ouvido e a justiça será feita. Ele está destruindo a ideologia de que o Estado nos protege, nos dá segurança, saúde e educação. Porque na verdade o Estado só existe para privilegiar os políticos, funcionários públicos de auto escalão, suas famílias e amigos. Enquanto que o povo sofre para sustentar a elite política. O protagonista Miguel entendeu isso quando a filha dele morreu na fila do SUS.

@ 2b24a1fa:17750f64

"Kleines Erste-Hilfe-Büchlein gegen Propaganda" von 2023. „Normalerweise hört man das Wort „Propaganda“ im Mainstream-Diskurs nur, wenn es um Dinge geht, die andere Länder ihren eigenen Bürgern antun oder Teil ausländischer Beeinflussungsoperationen sind, obwohl in der überwältigenden Mehrheit der Fälle, in denen wir in unserem täglichen Leben Propaganda erlebt haben, der Anruf aus dem eigenen Haus kam.“

https://soundcloud.com/radiomuenchen/helge-buttkereit-medienkritik-als-trotziger-idealismus?

In der Folge dokumentiert sie einige gravierende Beispiele aus den US-Medien. Auch in Deutschland fehlt es den Massenmedien an der nötigen Distanz zur Regierung und ihrem Werte-Narrativ. Was umso gefährlicher ist, da sie über „Definitionsmacht“ verfügen. Auch wenn wir selbst diese Medien nicht konsumieren, so können wir doch sicher sein, dass die große Mehrheit der Bürger sie konsultiert und damit deren Sicht auf die Welt massiv beeinflusst wird. „Wenn wir die Tagesschau einschalten, erfahren wir nichts über die ‘Wirklichkeit’. Wir lernen vielmehr, wer es geschafft hat, seine Sicht auf die Wirklichkeit in die Propaganda-Matrix einzuschreiben“, verrät der Medienwissenschaftler Michael Meyen in seinem Buch "Die Propaganda-Matrix". Nun gilt jedoch die Presse in der öffentlichen Wahrnehmung als „Vierte Gewalt“ der Demokratie. Ihre Aufgabe wäre es demnach, die zunehmend verflochtenen Staatsgewalten Legislative, Exekutive und Judikative zu kontrollieren. Die Realität sieht anders aus. Dabei übersieht selbst die immer häufiger auftretende Medienkritik, dass die „Vierte Gewalt“ von den Herrschenden nie in dieser Funktion gedacht war – schließlich waren und sind die Medien seit je her in den Händen von Regierungen und Konzernen, schreibt unser Autor Helge Buttkereit. Hören Sie seinen zweiteiligen Beitrag „Medienkritik als trotziger Idealismus“, der zunächst beim Magazin Multipolar erschienen war: multipolar-magazin.de/artikel/medien…tik-idealismus

Sprecher: Karsten Troyke

Bild-Collage: Radio München

@ 2b24a1fa:17750f64

Herzlichen Glückwunsch zu einem weiteren denkwürdigen Europa-Tag, den wir mit einem Manifest des european-peace-projects begehen. Europaweit beteiligen sich heute Institutionen, Vereine und Bürger, die um 17 Uhr die Fenster öffnen und dieses Manifest laut verlesen. Wer das nicht möchte oder kann, schaltet vielleicht Radio München ein:

\ https://soundcloud.com/radiomuenchen/european-peace-project-das-manifest-heute-17-uhr?

@ a39d19ec:3d88f61e

Nun da das deutsche Bundesregime den Ruin Deutschlands beschlossen hat, der sehr wahrscheinlich mit dem Werkzeug des Geld druckens "finanziert" wird, kamen mir so viele Gedanken zur Geldmengenausweitung, dass ich diese für einmal niedergeschrieben habe.

Die Ausweitung der Geldmenge führt aus klassischer wirtschaftlicher Sicht immer zu Preissteigerungen, weil mehr Geld im Umlauf auf eine begrenzte Menge an Gütern trifft. Dies lässt sich in mehreren Schritten analysieren:

1. Quantitätstheorie des Geldes

Die klassische Gleichung der Quantitätstheorie des Geldes lautet:

M • V = P • Y

wobei:
- M die Geldmenge ist,
- V die Umlaufgeschwindigkeit des Geldes,
- P das Preisniveau,
- Y die reale Wirtschaftsleistung (BIP).

Wenn M steigt und V sowie Y konstant bleiben, muss P steigen – also Inflation entstehen.

2. Gütermenge bleibt begrenzt

Die Menge an real produzierten Gütern und Dienstleistungen wächst meist nur langsam im Vergleich zur Ausweitung der Geldmenge. Wenn die Geldmenge schneller steigt als die Produktionsgütermenge, führt dies dazu, dass mehr Geld für die gleiche Menge an Waren zur Verfügung steht – die Preise steigen.

3. Erwartungseffekte und Spekulation

Wenn Unternehmen und Haushalte erwarten, dass mehr Geld im Umlauf ist, da eine zentrale Planung es so wollte, können sie steigende Preise antizipieren. Unternehmen erhöhen ihre Preise vorab, und Arbeitnehmer fordern höhere Löhne. Dies kann eine sich selbst verstärkende Spirale auslösen.

4. Internationale Perspektive

Eine erhöhte Geldmenge kann die Währung abwerten, wenn andere Länder ihre Geldpolitik stabil halten. Eine schwächere Währung macht Importe teurer, was wiederum Preissteigerungen antreibt.

5. Kritik an der reinen Geldmengen-Theorie

Der Vollständigkeit halber muss erwähnt werden, dass die meisten modernen Ökonomen im Staatsauftrag argumentieren, dass Inflation nicht nur von der Geldmenge abhängt, sondern auch von der Nachfrage nach Geld (z. B. in einer Wirtschaftskrise). Dennoch zeigt die historische Erfahrung, dass eine unkontrollierte Geldmengenausweitung langfristig immer zu Preissteigerungen führt, wie etwa in der Hyperinflation der Weimarer Republik oder in Simbabwe.

@ f3873798:24b3f2f3

Recentemente, assisti a um vídeo que me fez refletir profundamente sobre o impacto da linguagem na hora de vender. No vídeo, uma jovem relatava sua experiência ao presenciar um vendedor de amendoim em uma agência dos Correios. O local estava cheio, as pessoas aguardavam impacientes na fila e, em meio a esse cenário, um homem humilde tentava vender seu produto. Mas sua abordagem não era estratégica; ao invés de destacar os benefícios do amendoim, ele suplicava para que alguém o ajudasse comprando. O resultado? Ninguém se interessou.

A jovem observou que o problema não era o produto, mas a forma como ele estava sendo oferecido. Afinal, muitas das pessoas ali estavam há horas esperando e perto do horário do almoço – o amendoim poderia ser um ótimo tira-gosto. No entanto, como a comunicação do vendedor vinha carregada de desespero, ele afastava os clientes ao invés de atraí-los. Esse vídeo me tocou profundamente.

No dia seguinte, ao sair para comemorar meu aniversário, vi um menino vendendo balas na rua, sob o sol forte. Assim como no caso do amendoim, percebi que as pessoas ao redor não se interessavam por seu produto. Ao se aproximar do carro, resolvi comprar dois pacotes. Mais do que ajudar, queria que aquele pequeno gesto servisse como incentivo para que ele continuasse acreditando no seu negócio.

Essa experiência me fez refletir ainda mais sobre o poder da comunicação em vendas. Muitas vezes, não é o produto que está errado, mas sim a forma como o vendedor o apresenta. Quando transmitimos confiança e mostramos o valor do que vendemos, despertamos o interesse genuíno dos clientes.

Como a Linguagem Impacta as Vendas?

1. O Poder da Abordagem Positiva

Em vez de pedir por ajuda, é importante destacar os benefícios do produto. No caso do amendoim, o vendedor poderia ter dito algo como: "Que tal um petisco delicioso enquanto espera? Um amendoim fresquinho para matar a fome até o almoço!"

2. A Emoção na Medida Certa

Expressar emoção é essencial, mas sem parecer desesperado. Os clientes devem sentir que estão adquirindo algo de valor, não apenas ajudando o vendedor.

3. Conheça Seu Público

Entender o contexto é fundamental. Se as pessoas estavam com fome e impacientes, uma abordagem mais objetiva e focada no benefício do produto poderia gerar mais vendas.

4. Autoconfiança e Postura

Falar com firmeza e segurança transmite credibilidade. O vendedor precisa acreditar no próprio produto antes de convencer o cliente a comprá-lo.

Conclusão

Vender é mais do que apenas oferecer um produto – é uma arte que envolve comunicação, percepção e estratégia. Pequenos ajustes na abordagem podem transformar completamente os resultados. Se o vendedor de amendoim tivesse apresentado seu produto de outra maneira, talvez tivesse vendido tudo rapidamente. Da mesma forma, se cada um de nós aprender a se comunicar melhor em nossas próprias áreas, poderemos alcançar muito mais sucesso.

E você? Já passou por uma experiência parecida?

@ 266815e0:6cd408a5

While I was in Mediera with all the other awesome people at the first SEC cohort there where a lot of discussions around data storage on nostr and if it could be made censorship-resistent

I remember lots of discussions about torrents, hypercore, nostr relays, and of course IPFS

There were a few things I learned from all these conversations:

1. All the existing solutions have one thing in common. A universal ID of some kind for files
2. HTTP is still good. we don't have to throw the baby out with the bath water
3. nostr could fix this... somehow

Some of the existing solutions work well for large files, and all of them are decentralization in some way. However none of them seem capable of serving up cat pictures for social media clients. they all have something missing...

An Identity system

An identity system would allow files to be "owned" by users. and once files have owners servers could start grouping files into a single thing instead of a 1000+ loose files

This can also greatly simplify the question of "what is spam" for a server hosting (or seeding) these files. since it could simply have a whitelist of owners (and maybe their friends)

What is blossom?

Blossom is a set of HTTP endpoints that allow nostr users to store and retrieve binary data on public servers using the sha256 hash as a universal id

What are Blobs?

blobs are chunks of binary data. they are similar to files but with one key difference, they don't have names

Instead blobs have a sha256 hash (like b1674191a88ec5cdd733e4240a81803105dc412d6c6708d53ab94fc248f4f553) as an ID

These IDs are universal since they can be computed from the file itself using the sha256 hashing algorithm ( you can get a files sha256 hash on linux using: sha256sum bitcoin.pdf )

How do the servers work?

Blossom servers expose four endpoints to let clients and users upload and manage blobs

• GET /<sha256> (optional file .ext)
• PUT /upload
• Authentication: Signed nostr event
• Returns a blob descriptor
• GET /list/<pubkey>
• Returns an array of blob descriptors
• Authentication (optional): Signed nostr event
• DELETE /<sha256>
• Authentication: Signed nostr event

What is Blossom Drive?

Blossom Drive is a nostr app built on top of blossom servers and allows users to create and manage folders of blobs

What are Drives

Drives are just nostr events (kind 30563) that store a map of blobs and what filename they should have along with some extra metadata

An example drive event would be json { "pubkey": "266815e0c9210dfa324c6cba3573b14bee49da4209a9456f9484e5106cd408a5", "created_at": 1710773987, "content": "", "kind": 30563, "tags": [ [ "name", "Emojis" ], [ "description", "nostr emojis" ], [ "d", "emojis" ], [ "r", "https://cdn.hzrd149.com/" ], [ "x", "303f018e613f29e3e43264529903b7c8c84debbd475f89368cb293ec23938981", "/noStrudel.png", "15161", "image/png" ], [ "x", "a0e2b39975c8da1702374b3eed6f4c6c7333e6ae0008dadafe93bd34bfb2ca78", "/satellite.png", "6853", "image/png" ], [ "x", "e8f3fae0f4a43a88eae235a8b79794d72e8f14b0e103a0fed1e073d8fb53d51f", "/amethyst.png", "20487", "image/png" ], [ "x", "70bd5836807b916d79e9c4e67e8b07e3e3b53f4acbb95c7521b11039a3c975c6", "/nos.png", "36521", "image/png" ], [ "x", "0fc304630279e0c5ab2da9c2769e3a3178c47b8609b447a30916244e89abbc52", "/primal.png", "29343", "image/png" ], [ "x", "9a03824a73d4af192d893329bbc04cd3798542ee87af15051aaf9376b74b25d4", "/coracle.png", "18300", "image/png" ], [ "x", "accdc0cdc048f4719bb5e1da4ff4c6ffc1a4dbb7cf3afbd19b86940c01111568", "/iris.png", "24070", "image/png" ], [ "x", "2e740f2514d6188e350d95cf4756bbf455d2f95e6a09bc64e94f5031bc4bba8f", "/damus.png", "32758", "image/png" ], [ "x", "2e019f08da0c75fb9c40d81947e511c8f0554763bffb6d23a7b9b8c9e8c84abb", "/old emojis/astral.png", "29365", "image/png" ], [ "x", "d97f842f2511ce0491fe0de208c6135b762f494a48da59926ce15acfdb6ac17e", "/other/rabbit.png", "19803", "image/png" ], [ "x", "72cb99b689b4cfe1a9fb6937f779f3f9c65094bf0e6ac72a8f8261efa96653f5", "/blossom.png", "4393", "image/png" ] ] }

There is a lot going on but the main thing is the list of "x" tags and the path that describes the folder and filename the blob should live at

If your interested, the full event definition is at github.com/hzrd149/blossom-drive

Getting started

Like every good nostr client it takes a small instruction manual in order to use it properly. so here are the steps for getting started

1. Open the app

Open https://blossom.hzrd149.com

2. Login using extension

You can also login using any of the following methods using the input - NIP-46 with your https://nsec.app or https://flare.pub account - a NIP-46 connection string - an ncryptsec password protected private key - a nsec unprotected private key (please don't) - bunker:// URI from nsecbunker

3. Add a blossom server

Right now https://cdn.satellite.earth is the only public server that is compatible with blossom drive. If you want to host your own I've written a basic implementation in TypeScript github.com/hzrd149/blossom-server

4. Start uploading your files

NOTE: All files upload to blossom drive are public by default. DO NOT upload private files

5. Manage files

Encrypted drives

There is also the option to encrypt drives using NIP-49 password encryption. although its not tested at all so don't trust it, verify

Whats next?

I don't know, but Im excited to see what everyone else on nostr builds with this. I'm only one developer at the end of the day and I can't think of everything

also all the images in this article are stored in one of my blossom drives here

nostr:naddr1qvzqqqrhvvpzqfngzhsvjggdlgeycm96x4emzjlwf8dyyzdfg4hefp89zpkdgz99qq8xzun5d93kcefdd9kkzem9wvr46jka

@ 58d88196:bec81862

AI revolution is inevitable.

How to Win Using AI:

AI tools can enhance productivity, creativity, and efficiency. Those who adopt and master AI technologies can outperform others in their field, effectively "winning" by staying ahead. For example: In creative fields: AI can assist with generating ideas, editing, or automating repetitive tasks, allowing professionals to focus on high-value work.

In technical roles: AI can analyze data, optimize processes, or write code faster, giving users an edge.

In business: AI can provide insights through data analysis, improve customer service with chatbots, or streamline operations.

How to Win Using AI: Learn AI Tools: Familiarize yourself with AI platforms relevant to your industry (e.g., ChatGPT for writing, MidJourney for design, or TensorFlow for data science).

Automate Routine Tasks: Use AI to handle repetitive work, freeing up time for strategic thinking.

Enhance Skills: Combine AI with your expertise to produce better results faster—e.g., using AI to draft a report, then refining it with your unique insights.

Stay Competitive: Continuously adapt to new AI advancements to maintain an edge over those who don’t use AI.

@ 044da344:073a8a0e

Mein Thema kommt heute aus dem Kalender und hat gleich noch zu einem Video geführt. Internationaler Tag der Pressefreiheit – wie jedes Jahr am 3. Mai. Das Publikum liebt Ranglisten. Shanghai für die Hochschulen, der Best Country Report für die Lebensqualität und Freedom House für die Freiheit in der Welt. Es gibt Aufsteiger und Absteiger und Jahr für Jahr eine Meldung, über die sich trefflich diskutieren lässt – vor allem in Europa und Nordamerika, wo die Sieger wohnen. Man muss die Statistik dafür nicht einmal fälschen, sondern einfach nur das messen, was man selbst am besten kann, und alles weglassen, was das Bild trüben könnte. Bei den „Reportern ohne Grenzen“ sorgen dafür die Geldgeber und Fragen, die sich zum Beispiel in Afrika oder in Südostasien gar nicht stellen. Ergebnis: Die Medien sind bei uns ziemlich frei, auch wenn Leser dieser Seite wissen, dass das so nicht stimmt.

Okay: Deutschland hat es wieder nicht ganz geschafft in den grünen Bereich – dorthin, wo die skandinavischen Länder stehen, die Niederlande oder Irland. Deutschland gehört auch nicht mehr zu den Top Ten wie noch 2024, aber es war knapp. Platz elf. Zum Glück nennen die „Reporter ohne Grenzen“ die Schuldigen. Zensur? Gott bewahre. Das Ausblenden, Diffamieren, Verleumden von allen, die laut Fragen stellen zum Regierungskurs? Doch nicht bei uns. Dieses Land würde auch in Sachen Pressefreiheit längst Weltmeister sein, wenn da nicht ein paar Unverbesserliche wären, die auf Journalisten ungefähr so reagieren wie ein Stier auf ein rotes Tuch. Glaubt man den „Reportern ohne Grenzen“, dann sind Demos in Deutschland ein gefährlicher Ort für alle, die dort mit Kamera, Mikro oder Presseschild auftauchen. 75 „physische Angriffe“ 2024, davon die meisten in Berlin und beim Thema Nahost, wobei es zwei Bild-Reporter allein auf 29 Einträge gebracht haben (Iman Sefati und seine Fotografin Yalcin Askin).

Vorweg: Jede Attacke ist eine zu viel. Gleich danach kommt aber der Verdacht, dass das ganz gut passt, weil die „Reporter ohne Grenzen“ so eine „zunehmende Pressefeindlichkeit“ beklagen können und „ein verengtes Verständnis von Pressefreiheit“. Zitat: „Denn viele Bürger*innen sehen Berichterstattende, die nicht ihrem eigenen politischen Spektrum entstammen, mittlerweile als Gegner an.“

Sorry für die Genderei. Ich habe das so gelassen, weil es vermutlich bereits damit anfängt. Mit einem „verengten Verständnis“ auch und gerade bei der Sprache. Lassen Sie uns das in drei Schritten angehen. Nummer eins: Wir schauen auf den Kellner, der da jedes Jahr zum Welttag der Pressefreiheit eine Quittung ausstellt. Nummer zwei: Wir zählen nach. Und Nummer drei: Wir schlagen all das drauf, was in der Rechnung fehlt.

Die „Reporter ohne Grenzen“ sitzen in Paris und sind damit auf den ersten Blick weniger verdächtig als der US-Thinktank „Freedom House“, der bis 2017 jedes Jahr eine Konkurrenzliste veröffentlicht hat und einen Großteil seiner Gelder und Sicherheiten direkt oder indirekt aus dem Staatshaushalt in Washington bezieht. Der Volksmund weiß, was das Brot aus den Liedern macht, die draußen gesungen werden. Bei den „Reportern ohne Grenzen“ kommt das Geld aus ganz ähnlich Töpfen – 2023 zu drei Vierteln von der EU, von staatlichen Behörden und von den großen Stiftungen. Ford, Luminate (Geldbörse von Ebay-Gründer Pierre Omidyar, der auch bei den Faktencheckern mitspielt), Open Society Foundations. Der deutsche Steuerzahler ist über ein Ministerium (Entwicklungshilfe) und den Berliner Senat jeweils mit einer Viertelmillion Euro dabei. Dass die Niederlande und Schweden mitspielen, erklärt sich bei einem Blick auf die Ergebnisse (in diesem Jahr: Platz 3 und 4). Besser kann man nicht investieren in Werbung für das eigene Land.

Diese Platzierungen sind gewissermaßen ein Selbstläufer, weil all das in die Wertung kommt, was der Westen gut findet – die formale Trennung von Regierung und Redaktionen zum Beispiel. Andersherum: Abzüge gibt es überall da, wo der Staat, Parteien oder Politiker selbst Medien betreiben. In Uganda zum Beispiel, Platz 143, gibt es kaum Werbetreibende, die ein TV-Programm finanzieren könnten, und nur ein kleines Publikum, das sich ein Zeitungsabo leisten kann und will. Sonntags drängen sich die Menschen dort vor kleinen Hütten mit großen Bildschirmen, um ihren Lieblingen aus der Premier League zuzujubeln und vielleicht einen Wettgewinn einzustreichen, der sie über die Woche trägt. Auf dem Land gehören die Radiostationen in aller Regel lokalen Größen. Kirche, Politik, Wirtschaft. Ich habe dort Interviews geführt und gelernt: Über „Pressefreiheit“ und Informationsqualität sagt das alles wenig. Die Menschen in Uganda wissen sehr genau, wer jeweils zu ihnen spricht, und machen sich ihren Reim darauf. Ein anderer Kriterienkatalog könnte daraus ein Qualitätsmerkmal machen. Während Besitz- und damit Machtverhältnisse im Westen hinter Nebelkerzen versteckt werden (Objektivität, Unabhängigkeit, Neutralität), herrscht in Uganda Transparenz.

Neben dem „politischen Kontext“ haben die „Reporter ohne Grenzen“ vier weitere Blöcke in ihrem Punktekatalog. Gesetze, Wirtschaft, Gesellschaft, Sicherheit. Die Fragen decken das ab, was bei uns Standard ist. Dürfen sich Journalisten gewerkschaftlich organisieren? Werden sie bestochen? Können Nachrichtenmedien finanziell überleben? Werden Karikaturen toleriert? Ich will hier nicht zu sehr auf Uganda herumreiten. Nur: Der Beruf wird dort völlig anders gesehen als hier. Es gibt nur eine kleine vierstellige Zahl an Journalisten. 1000, vielleicht 1500. Die meisten sind jung, weil die Redaktionen als Sprungbrett gesehen werden zu einem wirklich lukrativen Job in der Verwaltung, in den Unternehmen, in der Politik. Wer zu einer Pressekonferenz fährt, erwartet dort einen Umschlag. Offiziell: Anreisepauschale. Inoffiziell der Preis für einen wohlwollenden Bericht. Die „Reporter ohne Grenzen“ strafen Uganda folglich ab. Angriffe auf Journalisten (oft von Sicherheitsleuten), wenig Schutz vor Gericht, wenig Achtung vor dem Beruf. Platz 143 halt.

Und Deutschland? Die Demos wie gesagt und Leute, die die Dinge einfach falsch sehen. Ein „verengtes Verständnis von Pressefreiheit“. Außerdem sagen die „Reporter ohne Grenzen“: Wir tun zu wenig gegen „Hassrede und Desinformation“. Der Koalitionsvertrag von Schwarz-Rot ist offenbar nicht mehr eingeflossen in diesen Bericht. Dort heißt es:

Gezielte Einflussnahme auf Wahlen sowie inzwischen alltägliche Desinformation und Fake News sind ernste Bedrohungen für unsere Demokratie, ihre Institutionen und den gesellschaftlichen Zusammenhalt. Die bewusste Verbreitung falscher Tatsachenbehauptungen ist durch die Meinungsfreiheit nicht gedeckt. Deshalb muss die staatsferne Medienaufsicht unter Wahrung der Meinungsfreiheit auf der Basis klarer gesetzlicher Vorgaben gegen Informationsmanipulation sowie Hass und Hetze vorgehen können.

Schon vorab hatten die „Reporter ohne Grenzen“ von „einem stark verengten Meinungskorridor bei der Arbeit zu Israel und Palästina“ berichtet. Selbst alte Hasen haben in dieser Befragung gesagt, dass sie noch nie einen solchen Druck erlebt hätten – vor allem dann, wenn es um die israelische Kriegsführung geht, um die Folgen für die Bevölkerung in Gaza und um das, was in Deutschland zu diesem Thema passiert. Ich verlinke hier die Münchner Rede von Andreas Zumach, gehalten im November 2018, wo all das schon Thema war.

Und sonst? Corona, Ukraine, Klima und damit Energiewende? Kontokündigungen? Gerichtsurteile, die selbst es bis in die Weltpresse schafften (im Bild: The Economist vom 16. April 2025) und dort Unbehagen auslösten? Eine Cancel Culture, die Sprecher aus der Öffentlichkeit verbannt, die sich gegen die herrschende Ideologie und den Regierungskurs stellen?

Alles kein Thema – jedenfalls nicht für die Experten, die gefragt werden (Journalisten, Forscher, Akademiker, Menschenrechtsspezialisten; mithin Menschen, die in irgendeiner Form von Staat oder Konzernen abhängen). Die konzernfreien oder neuen Medien senden für die „Reporter ohne Grenzen“ offenbar jenseits von Gut und Böse. Und dass die Regierung Fernsehen, Radio und Presse nicht unbedingt selbst betreiben muss wie in Uganda, um ihre Sicht der Dinge flächendeckend zu verbreiten, scheint dort außerhalb jeder Vorstellungskraft zu liegen. Anders ist nicht zu erklären, dass im Bericht zwar ein paar öffentlich-rechtliche Skandälchen auftauchen und der Stellenabbau bei der Südwestdeutschen Medienholding, aber nichts zu lesen ist über die Aufrüstung der Medienapparate in Ministerien, Parteien, Unternehmen und über den Druck, der davon auf Journalisten ausgeht, die zwar keinen Umschlag bekommen, wenn sie ordentlich berichten, aber sicher ein wenig Exklusives, wahrscheinlich eine Beförderung und vielleicht sogar ein Ticket für den Sprung auf die andere, besser entlohnte Seite. Bis es soweit ist, melden sie einfach, dass mit der Medienfreiheit alles okay ist, wenn es da nicht diese Chaoten auf der Straße geben würde und ein paar Unverbesserliche mit einem „verengten Verständnis von Pressefreiheit“. Sonst müsste man sich möglicherweise aufmachen und nach den Ursachen für den Unmut fragen.

Michael Meyen: Videos

Freie Akademie für Medien & Journalismus

Unterstützen

@ 000002de:c05780a7

I've been eager to share my thoughts on "Return of the Strong Gods" by R.R. Reno since I finished it a week ago.

I found this book incredibly insightful. @SimpleStacker's excellent review prompted me to pick it up, and I'm glad I did. While I won't be providing a full review, I will share some of the key insights and thoughts that resonated with me.

Reno masterfully dissects the sociological underpinnings of the political shifts in the US and the Western world over the past decade and a half. His analysis of the rise of populism and nationalism is compelling and rings true to my personal observations. Reno's central thesis is that post-WW2, the West embraced "weaker gods"—ideals like democracy, pluralism, and liberalism—fearing a repeat of the strong nationalistic sentiments that led to Hitler's rise. He argues that this shift has left many people feeling culturally homeless and desperate for strong leadership that listens to their grievances.

A significant portion of Reno's argument is built on the ideas of Karl Popper, a philosopher I was unfamiliar with before reading this book. Popper's work "The Open Society and Its Enemies" has significantly influenced post-war consensus, which Reno argues has led to a disconnect between the political elite and the common people. This disconnect, he posits, is a primary driver of populist sentiments.

Reno also delves into economics, discussing Friedrich Hayek and his agreement with some of Popper's positions. This intersection of philosophy and economics provides a unique lens through which to view the political landscape. Reno's mention of the Treaty of Versailles as a catalyst for Hitler's rise is a point often overlooked in discussions about WW2. He argues that the punitive measures imposed on Germany created an environment ripe for a strongman to emerge.

One of the most compelling aspects of Reno's argument is his explanation of how the political elite often lose touch with the values and wishes of the people they represent. He draws a powerful analogy between cultural homelessness and the desperation that drives people to seek strong leadership. This section of the book particularly resonated with me, as it aligns with my own observations of the political climate.

I would have liked Reno to start his analysis with Woodrow Wilson, whose "making the world safe for democracy" slogan embodied a form of Christian nationalism. Wilson's ideals and the post-WW1 environment laid the groundwork for the open society movement, which Reno critiques. Exploring this historical context could have strengthened Reno's argument.

Reno occasionally conflates economic liberalism with libertinism, which I found to be a minor flaw in an otherwise strong argument. He rightly points out the need for moral ethics in society but seems to overlook the distinction between economic freedom and moral laxity. Reno's discussion of Milton Friedman's ideas further highlights this confusion. While Reno argues that free trade has contributed to many of our modern ills, I believe the issue lies more with nation-state trade agreements like NAFTA, which are not true examples of free trade.

Another area where I disagree with Reno is his conflation of the nation with the state. Nations are cultural entities that predate and can exist independently of states. Reno's argument would be stronger if he acknowledged this distinction, as it would clarify his points about national pride and cultural heritage.

Reno's final chapters offer a cautionary tale about the return of strong gods and the danger of making them idols. He warns against authoritarianism and the overreach of the state, advocating for a balance that respects cultural heritage without succumbing to nationalism.

In conclusion, "Return of the Strong Gods" is a thought-provoking exploration of the political and cultural shifts of our time. Reno's insights are valuable, and his arguments, while not without flaws, provide a fresh perspective on the rise of populism and nationalism. I recommend this book to anyone seeking a deeper understanding of the forces shaping our world today.

originally posted at https://stacker.news/items/975849

@ b2d670de:907f9d4a

onion-service-nostr-relays

A list of nostr relays exposed as onion services.

The list

| Relay name | Description | Onion url | Operator | Payment URL | Payment options | | --- | --- | --- | --- | --- | --- | | nostr.oxtr.dev | Same relay as clearnet relay nostr.oxtr.dev | ws://oxtrdevav64z64yb7x6rjg4ntzqjhedm5b5zjqulugknhzr46ny2qbad.onion | operator | N/A | N/A | | relay.snort.social | Same relay as clearnet relay relay.snort.social | wss://skzzn6cimfdv5e2phjc4yr5v7ikbxtn5f7dkwn5c7v47tduzlbosqmqd.onion | operator | N/A | N/A | | nostr.thesamecat.io | Same relay as clearnet relay nostr.thesamecat.io | ws://2jsnlhfnelig5acq6iacydmzdbdmg7xwunm4xl6qwbvzacw4lwrjmlyd.onion | operator | N/A | N/A | | nostr.land | The nostr.land paid relay (same as clearnet) | ws://nostrland2gdw7g3y77ctftovvil76vquipymo7tsctlxpiwknevzfid.onion | operator | Payment URL | BTC LN | | bitcoiner.social | No auth required, currently | ws://bitcoinr6de5lkvx4tpwdmzrdfdpla5sya2afwpcabjup2xpi5dulbad.onion | operator | N/A | N/A | | relay.westernbtc.com | The westernbtc.com paid relay | ws://westbtcebhgi4ilxxziefho6bqu5lqwa5ncfjefnfebbhx2cwqx5knyd.onion | operator | Payment URL | BTC LN | | freelay.sovbit.host | Free relay for sovbit.host | ws://sovbitm2enxfr5ot6qscwy5ermdffbqscy66wirkbsigvcshumyzbbqd.onion | operator | N/A | N/A | | nostr.sovbit.host | Paid relay for sovbit.host | ws://sovbitgz5uqyh7jwcsudq4sspxlj4kbnurvd3xarkkx2use3k6rlibqd.onion | operator | N/A | N/A | | nostr.wine | 🍷 nostr.wine relay | ws://nostrwinemdptvqukjttinajfeedhf46hfd5bz2aj2q5uwp7zros3nad.onion | operator | Payment URL | BTC LN, BTC, Credit Card/CashApp (Stripe) | | inbox.nostr.wine | 🍷 inbox.nostr.wine relay | ws://wineinboxkayswlofkugkjwhoyi744qvlzdxlmdvwe7cei2xxy4gc6ad.onion | operator | Payment URL | BTC LN, BTC | | filter.nostr.wine | 🍷 filter.nostr.wine proxy relay | ws://winefiltermhqixxzmnzxhrmaufpnfq3rmjcl6ei45iy4aidrngpsyid.onion | operator | Payment URL | BTC LN, BTC | | N/A | N/A | ws://pzfw4uteha62iwkzm3lycabk4pbtcr67cg5ymp5i3xwrpt3t24m6tzad.onion:81 | operator | N/A | N/A | | nostr.fractalized.net | Free relay for fractalized.net | ws://xvgox2zzo7cfxcjrd2llrkthvjs5t7efoalu34s6lmkqhvzvrms6ipyd.onion | operator | N/A | N/A | | nfrelay.app | nfrelay.app aggregator relay (nostr-filter-relay) | ws://nfrelay6saohkmipikquvrn6d64dzxivhmcdcj4d5i7wxis47xwsriyd.onion | operator | N/A | N/A | relay.nostr.net | Public relay from nostr.net (Same as clearnet) | ws://nostrnetl6yd5whkldj3vqsxyyaq3tkuspy23a3qgx7cdepb4564qgqd.onion | operator | N/A | N/A | | nerostrator | Free to read, pay XMR to relay | ws://nerostrrgb5fhj6dnzhjbgmnkpy2berdlczh6tuh2jsqrjok3j4zoxid.onion | operator |Payment URL | XMR | | nostr.girino.org | Public relay from nostr.girino.org | ws://gnostr2jnapk72mnagq3cuykfon73temzp77hcbncn4silgt77boruid.onion | operator | N/A | N/A | | wot.girino.org | WoT relay from wot.girino.org | ws://girwot2koy3kvj6fk7oseoqazp5vwbeawocb3m27jcqtah65f2fkl3yd.onion | operator | N/A | N/A | | haven.girino.org/{outbox, inbox, chat, private} | Haven smart relay from haven.girino.org | ws://ghaven2hi3qn2riitw7ymaztdpztrvmm337e2pgkacfh3rnscaoxjoad.onion/{outbox, inbox, chat, private} | operator | N/A | N/A | | relay.nostpy.lol | Free Web of Trust relay (Same as clearnet) | ws://pemgkkqjqjde7y2emc2hpxocexugbixp42o4zymznil6zfegx5nfp4id.onion | operator |N/A | N/A | | Poster.place Nostr Relay | N/A | ws://dmw5wbawyovz7fcahvguwkw4sknsqsalffwctioeoqkvvy7ygjbcuoad.onion | operator | N/A | N/A | | Azzamo Relay | Azzamo Premium Nostr relay. (paid) | ws://q6a7m5qkyonzb5fk5yv4jyu3ar44hqedn7wjopg737lit2ckkhx2nyid.onion | operator | Payment URL | BTC LN | | Azzamo Inbox Relay | Azzamo Group and Private message relay. (Freemium) | ws://gp5kiwqfw7t2fwb3rfts2aekoph4x7pj5pv65re2y6hzaujsxewanbqd.onion | operator | Payment URL | BTC LN | | Noderunners Relay | The official Noderunners Nostr Relay. | ws://35vr3xigzjv2xyzfyif6o2gksmkioppy4rmwag7d4bqmwuccs2u4jaid.onion | operator | Payment URL | BTC LN |

Contributing

Contributions are encouraged to keep this document alive. Just open a PR and I'll have it tested and merged. The onion URL is the only mandatory column, the rest is just nice-to-have metadata about the relay. Put N/A in empty columns.

If you want to contribute anonymously, please contact me on SimpleX or send a DM on nostr using a disposable npub.

Operator column

It is generally preferred to use something that includes a NIP-19 string, either just the string or a url that contains the NIP-19 string in it (e.g. an njump url).

@ a3c6f928:d45494fb

Freedom—a word that resonates deeply within the hearts of many. It is a concept that transcends cultures, boundaries, and time itself. From the pages of history to the hopes of future generations, the quest for freedom has always been at the core of human existence.

What Is Freedom?

At its simplest, freedom is the power or right to act, speak, or think as one wants without hindrance or restraint. But in reality, it is far more nuanced. Freedom is not just about the absence of oppression; it is about the presence of opportunity—the chance to pursue one's dreams, express thoughts without fear, and live in harmony with one’s beliefs.

The Many Faces of Freedom

1. Political Freedom: The right to participate in governance, to vote, and to have a voice in decision-making.

2. Economic Freedom: The ability to work, own property, and engage in business without unreasonable restrictions.

3. Social Freedom: The acceptance of diversity and the ability to live without discrimination.

4. Personal Freedom: The right to privacy, personal choices, and the liberty to define one's own path.

Why Freedom Matters

Freedom matters because it is the foundation of innovation and progress. Societies that encourage freedom allow their people to think differently, to challenge the status quo, and to bring about change. Without freedom, creativity is stifled, voices are silenced, and growth becomes stagnant.

Protecting and Valuing Freedom

Freedom is fragile. It must be protected with vigilance and cherished with gratitude. History is filled with examples where freedom was hard-won and even harder to maintain. Today, as we navigate an interconnected world, the call to safeguard freedom is as loud as ever.

A Call to Action

Cherish your freedoms, no matter how small they may seem. Speak up for those who cannot. Stand firm against injustice. Remember, freedom is not just a privilege; it is a responsibility.

---

“Freedom is never voluntarily given by the oppressor; it must be demanded by the oppressed.” — Martin Luther King Jr.

Embrace it. Protect it. Share it.

@ b2d670de:907f9d4a

This is a list of nostr clients exposed as onion services. The list is currently actively maintained on GitHub. Contributions are always appreciated!

| Client name | Onion URL | Source code URL | Admin | Description | | --- | --- | --- | --- | --- | | Snort | http://agzj5a4be3kgp6yurijk4q7pm2yh4a5nphdg4zozk365yirf7ahuctyd.onion | https://git.v0l.io/Kieran/snort | operator | N/A | | moStard | http://sifbugd5nwdq77plmidkug4y57zuqwqio3zlyreizrhejhp6bohfwkad.onion/ | https://github.com/rafael-xmr/nostrudel/tree/mostard | operator | minimalist monero friendly nostrudel fork | | Nostrudel | http://oxtrnmb4wsb77rmk64q3jfr55fo33luwmsyaoovicyhzgrulleiojsad.onion/ | https://github.com/hzrd149/nostrudel | operator | Runs latest tagged docker image | | Nostrudel Next | http://oxtrnnumsflm7hmvb3xqphed2eqpbrt4seflgmdsjnpgc3ejd6iycuyd.onion/ | https://github.com/hzrd149/nostrudel | operator | Runs latest "next" tagged docker image | | Nsite | http://q457mvdt5smqj726m4lsqxxdyx7r3v7gufzt46zbkop6mkghpnr7z3qd.onion/ | https://github.com/hzrd149/nsite-ts | operator | Runs nsite. You can read more about nsite here. | | Shopstr | http://6fkdn756yryd5wurkq7ifnexupnfwj6sotbtby2xhj5baythl4cyf2id.onion/ | https://github.com/shopstr-eng/shopstr-hidden-service | operator | Runs the latest serverless branch build of Shopstr. |

@ 866e0139:6a9334e5

Autor: Friderike Komárek. Dieser Beitrag wurde mit dem Pareto-Client geschrieben. Sie finden alle Texte der Friedenstaube und weitere Texte zum Thema Frieden hier. Die neuesten Pareto-Artikel finden Sie in unserem Telegram-Kanal.

---

Die neuesten Artikel der Friedenstaube gibt es jetzt auch im eigenen Friedenstaube-Telegram-Kanal.

---

Was grade war, ist schief.

Wer Frieden will, ist böse.

Wer tötet, der ist lieb.

Gesund ist nur symptomlos krank,

Abstand ist gefühlte Nähe,

Maskenatmen – Gott sei Dank!

Fakten dienen Hass und Hetze,

Lügen tun gut.

Wer Fakten nennt, der wird zensiert,

Wahrheit schafft nur böses Blut.

Für Frieden braucht man Krieg,

für Meinungsfreiheit die Zensur.

Demokratie, die braucht Verbote,

fürs Klima zerstört man die Natur.

Mann ist Frau

und Frau ist Mann.

Ein Glück, dass man

die Biologie jetzt lenken kann!

Der Größenwahn beherrscht die Welt,

hat alles auf den Kopf gestellt.

Kritiker wandern als Kriminelle ins Gefängnis.

Mit ihren Gedanken bringen sie

die andern in Bedrängnis.

Was schief war, das ist grade.

Was grade war, ist schief.

---

LASSEN SIE DER FRIEDENSTAUBE FLÜGEL WACHSEN!

Hier können Sie die Friedenstaube abonnieren und bekommen die Artikel zugesandt.

Schon jetzt können Sie uns unterstützen:

• Für 50 CHF/EURO bekommen Sie ein Jahresabo der Friedenstaube.
• Für 120 CHF/EURO bekommen Sie ein Jahresabo und ein T-Shirt/Hoodie mit der Friedenstaube.
• Für 500 CHF/EURO werden Sie Förderer und bekommen ein lebenslanges Abo sowie ein T-Shirt/Hoodie mit der Friedenstaube.
• Ab 1000 CHF werden Sie Genossenschafter der Friedenstaube mit Stimmrecht (und bekommen lebenslanges Abo, T-Shirt/Hoodie).

Für Einzahlungen in CHF (Betreff: Friedenstaube):

Für Einzahlungen in Euro:

Milosz Matuschek

IBAN DE 53710520500000814137

BYLADEM1TST

Sparkasse Traunstein-Trostberg

Betreff: Friedenstaube

Wenn Sie auf anderem Wege beitragen wollen, schreiben Sie die Friedenstaube an: friedenstaube@pareto.space

---

Sie sind noch nicht auf Nostr and wollen die volle Erfahrung machen (liken, kommentieren etc.)? Zappen können Sie den Autor auch ohne Nostr-Profil! Erstellen Sie sich einen Account auf Start. Weitere Onboarding-Leitfäden gibt es im Pareto-Wiki.

@ 04ea4f83:210e1713

30. November 2022

Sehr geehrter Herr Bindseil und Herr Schaff von der Europäischen Zentralbank,

Ich schreibe Ihnen heute, am Tag der Veröffentlichung Ihres EZB-Blog-Berichts „Bitcoin's Last Stand", sowohl mit Belustigung als auch mit Bestürzung. Ich amüsiere mich darüber, wie albern und hilflos Sie beide erscheinen, indem Sie sich auf müde und längst widerlegte Erzählungen über Bitcoin und seine Nutzlosigkeit und Verschwendung stützen. Und ich bin beunruhigt, weil ich von zwei sehr gut ausgebildeten und etablierten Mitgliedern Ihres Fachgebiets eine viel differenziertere kritische Sichtweise auf den aufkeimenden Bitcoin und die Lightning Skalierungslösung erwartet hätte.

Sie haben sich mit Ihren dilettantischen Versuchen, Angst, Unsicherheit und Zweifel an einem globalen Open-Source-Kooperationsprojekt zu säen, das als ein ständig wachsendes Wertspeicher und -übertragungssystem für viele Millionen Menschen weltweit fungiert, wirklich einen Bärendienst erwiesen. Ein System, das jedes Jahr von mehr und mehr Menschen genutzt wird, da sie von seiner Effektivität und seinem Nutzen erfahren. Und ein System, das noch nie gehackt oder geknackt wurde, das funktioniert, um die „Banklosen" zu versorgen, besonders in den Ländern und Orten, wo sie von finsteren totalitären Regierungen schwer unterdrückt oder von der finanziell „entwickelten" Welt einfach im Stich gelassen wurden. In der Tat ist Bitcoin bereits gesetzliches Zahlungsmittel in El Salvador und der Zentralafrikanischen Republik, und erst gestern erhielt er in Brasilien den Status eines „Zahlungsmittels".

Es entbehrt nicht einer gewissen Ironie, wenn ich schreibe, dass Sie das Ziel so gründlich verfehlen, insbesondere weil die Bank- und Finanzsysteme, zu denen Sie gehören, für eine Energie- und Materialverschwendung verantwortlich sind, die um Größenordnungen größer ist als die Systeme und Ressourcen, die das Bitcoin-Netzwerk antreiben und erhalten. Ich bin mir sicher, dass Sie sich der revolutionären kohlenstoff- und treibhausgasreduzierenden Effekte bewusst sind, die Bitcoin-Mining-Anlagen haben, wenn sie neben Methan-emittierenden Mülldeponien und/oder Ölproduktionsanlagen angesiedelt sind. Und ich weiß, dass Sie auch gut über solar- und windbetriebene Bitcoin-Mining-Cluster informiert sind, die dabei helfen, Mikronetze in unterversorgten Gemeinden einzurichten.

Ich könnte noch weiter darüber sprechen, wie das Lightning-Netzwerk implementiert wird, um Überweisungszahlungen zu erleichtern sowie Finanztechnologie und Souveränität in Gemeinden in Laos und Afrika südlich der Sahara zu bringen. Aber lassen Sie mich zu dem Teil kommen, der einen gewöhnlichen Menschen wie mich einfach zutiefst traurig macht. Bitcoin ist, wie Sie sehr wohl wissen (trotz Ihrer dummen und veralteten Verleumdungen), ein technologisches Netzwerk, das nicht auf nationaler oder internationaler Verschuldung oder der Laune von Politikern basiert oder durch sie entwertet wird. Es ist ein System, das jenseits der Kontrolle einer einzelnen Person, eines Landes oder einer Gruppe von Ländern liegt. Wenn Bitcoin sprechen könnte (was er in der Tat ungefähr alle zehn Minuten tut, durch das elektro-mathematische Knistern und Summen des Wahrheitsfeuers), würde er diese Worte aussprechen:

„Über allen Völkern steht die Menschlichkeit".\ \ Als Bankiers der Europäischen Union, als Menschen von der Erde, als biologische Wesen, die denselben Gesetzen des Verfalls und der Krankheit unterliegen wie alle anderen Wesen, wäre es da nicht erfrischend für Sie beide, das Studium und die Teilnahme an einer Technologie zu begrüßen, die die Arbeit und die Bemühungen der sich abmühenden Menschen auf unserem Planeten bewahrt, anstatt sie zu entwerten? Wie die Bitcoin-Kollegin Alyse Killeen wiederholt gesagt hat: „Bitcoin ist FinTech für arme Menschen".

Ich bin dankbar für Ihre Aufmerksamkeit und hoffe, dass Sie über Bitcoin nachdenken und es gründlicher studieren werden.

Mit freundlichen Grüßen,

Cosmo Crixter

@ a5ee4475:2ca75401

Título H1 - Formatação Markdown

[Titulo com '# ' antes do texto, pode não funcionar se o título H1 for iniciado depois de um texto normal]

list #descentralismo #markdown #clients #Amethyst #Yakihonne

Título H2 [2 hashtags e espaço]

Título H3 [3 hashtags e espaço]

Título H4 [4 hashtags e espaço]

Título H5 [5 hashtags e espaço]

Título H6 [6 hashtags e espaço]

*Copie e cole o texto para enxergar os caracteres usados

---

Réguas horizontais

• Com 3 sublinhados (_) seguidos:

---

• Com 3 hífens (-) seguidos:

---

• Com três asteriscos (*) seguidos:

---

---

Ênfases

Negrito: - Dois asteriscos antes e depois: Este é um texto em negrito

• Dois sublinhados antes e depois: Esse é um texto em negrito

Itálico - Um asterisco antes e um depois: Esse é um texto em itálico

• Um sublinhado antes e um depois: Esse é um texto em itálico

Tachado:

~~Aqui houve uma rasura~~

---

Bloco de citações

Usando 1 a 3 “>”:

O bloco de citações pode ser eninhado…

…Usando cada vez mais maior-que (>).

…Mesmo com espaços entre eles.

---

Listas

Não-ordenadas

• Crie um tópico começando com +, - ou *.
• Subtópicos são feitos adicionando 2 espaços:
• A mudança da marcação inicial não altera a lista:
  • Com asterisco
  • Com sinal de mais
  • Com sinal de menos
• Muito fácil!

Ordenadas

1. Lorem ipsum dolor sit amet
2. Consectetur adipiscing elit
3. Integer molestie lorem at massa
4. Você pode usar números em sequência...
5. ...ou deixar tudo como 1. ou outro número.

O número inicia com recuos:

1. foo
2. bar

---

Códigos

código na mesma linha

Caixa de código

• Códigos intentados com 4 espaços:

  // Some comments line 1 of code line 2 of code line 3 of code

• Com 3 acentos graves antes e depois:

Marcação de texto:

Insira o texto aqui...

Marcação de sintaxe:

``` js var foo = function (bar) { return bar++; };

console.log(foo(5)); ```

---

Tabelas

| APP | Descrição | | ------ | ----------- | | Element | App de mensagens que usa a rede Matrix. | | Simplex | App de mensagens bastante usado. | | 0xchat | App de mensagens no Nostr. |

---

Links

• Seu texto para o link

• Link entitulado

• Link autoconvertido https://github.com/nodeca/pica (habilite o linkify para ver)

---

Imagens nomeadas

Minion:

Stormtroopocat:

Como links, imagens também tem sintaxe footnote ‘!’ + ‘Outro texto’...

…com uma referência id posterior da referência na localização da URL.

---

Plugins

O recurso de markdown-it é um suporte muito eficaz de plugins de sintaxe.

---

Emojis

*Acesse o link para entender melhor

Marcação clássica: :wink: :cry: :laughing: :yum:

Figuras Ascii (emoticons): :-) :-( 8-) ;)

Veja como mudar a exibição com o twemoji.

---

Sobrescrito / Subscrito

*Acesse os links para entender melhor

• 19^th^
• H~2~O

---

\

*Acesse o link para entender melhor

++Texto Inserido++

---

\

*Acesse o link para entender melhor

==Texto marcado==

---

Notas de Rodapé

*Acesse o link para entender melhor

Nota de rodapé 1 link[^primeiro].

Nota de rodapé 2 link[^segundo].

Rodapé^[Texto do rodapé na linha] definição na linha.

Referência duplicada no rodapé[^segundo].

[^primeiro]: Rodapé pode ter marcação

e múltiplos parágrafos.

[^segundo]: Texto de rodapé.

---

Listas de Definição

*Acesse o link para entender melhor

Termo 1

: Definição 1 com continuação preguiçosa.

Termo 2 com marcação na linha

: Definição 2

    { algum código, parte da Definição 2 }

Third paragraph of definition 2.

Estilo compacto:

Termo 1 ~ Definição 1

Termo 2 ~ Definição 2a ~ Definição 2b

---

Esse texto é uma adaptação do:

nostr:nevent1qqsv54qfgtme38r2tl9v6ghwfj09gdjukealstkzc77mwujr56tgfwspzamhxue69uhhyetvv9ujumn0wd68ytnzv9hxgtczyqy0j6zknu2lr7qrge5yt725azecflhxv6d2tzwgtwrql5llukdqjqcyqqqqqqgfdk5w3

@ 9967f375:04f9a5e1

El insigne mendocino Juan Fernando Segovia falleció en el día de la festividad de Nuestra Señora de Luján, fecha significativa no sólo por ser la Patrona ríoplatense, sino además, anecdóticamente, porque cuando conocimos al profesor en tierras mejicanas tlaxcaltecas, escuchando la Santa Misa en la catedral (oficiada por el P. José Ramón García Gallardo); en un altar lateral coronandolo se encuentra una imágen de la Virgen muy parecida a la advocación, al hacerlo notar al profesor, la contempló sonriente y con mucha Fe. Este breve hecho significativo, sin duda fundamentó la labor abierta de Juan Fernando Segovia de ser fiel apóstol intelectual por los pueblos hispánicos, pues no sólo vino a compartir su sabiduría política, jurídica y moral, además de su genial convivencia con los asistentes en una, sino en las tres ediciones de las Conversaciones de la Ciudad Católica de Tlaxcala, haciendo notar la sinrazón de la cerrazón propia del nacionalismo (sin importar el apellido que le acompañe). Los Círculos Tradicionalistas de toda la Nueva España (cuyos buenos frutos son en gran parte obra de la labor incansable, conferencias presenciales y virtuales, libros y artículos de revistas para la conformación y formación continua de sus miembros), lamenta el vacío por la partida del maestro Juan Fernando Segovia.

Que Cristo Rey, a quien fielmente sirvió durante su vida, le dé el descanso eterno.

(Juan Fernando Segovia al centro, junto al P. José Ramón García y el matador Jerónimo Ramírez de Arellano en Tlaxcala, 2018).

@ 460c25e6:ef85065c

If you don't know where your posts are, you might as well just stay in the centralized Twitter. You either take control of your relay lists, or they will control you. Amethyst offers several lists of relays for our users. We are going to go one by one to help clarify what they are and which options are best for each one.

Public Home/Outbox Relays

Home relays store all YOUR content: all your posts, likes, replies, lists, etc. It's your home. Amethyst will send your posts here first. Your followers will use these relays to get new posts from you. So, if you don't have anything there, they will not receive your updates.

Home relays must allow queries from anyone, ideally without the need to authenticate. They can limit writes to paid users without affecting anyone's experience.

This list should have a maximum of 3 relays. More than that will only make your followers waste their mobile data getting your posts. Keep it simple. Out of the 3 relays, I recommend: - 1 large public, international relay: nos.lol, nostr.mom, relay.damus.io, etc. - 1 personal relay to store a copy of all your content in a place no one can delete. Go to relay.tools and never be censored again. - 1 really fast relay located in your country: paid options like http://nostr.wine are great

Do not include relays that block users from seeing posts in this list. If you do, no one will see your posts.

Public Inbox Relays

This relay type receives all replies, comments, likes, and zaps to your posts. If you are not getting notifications or you don't see replies from your friends, it is likely because you don't have the right setup here. If you are getting too much spam in your replies, it's probably because your inbox relays are not protecting you enough. Paid relays can filter inbox spam out.

Inbox relays must allow anyone to write into them. It's the opposite of the outbox relay. They can limit who can download the posts to their paid subscribers without affecting anyone's experience.

This list should have a maximum of 3 relays as well. Again, keep it small. More than that will just make you spend more of your data plan downloading the same notifications from all these different servers. Out of the 3 relays, I recommend: - 1 large public, international relay: nos.lol, nostr.mom, relay.damus.io, etc. - 1 personal relay to store a copy of your notifications, invites, cashu tokens and zaps. - 1 really fast relay located in your country: go to nostr.watch and find relays in your country

Terrible options include: - nostr.wine should not be here. - filter.nostr.wine should not be here. - inbox.nostr.wine should not be here.

DM Inbox Relays

These are the relays used to receive DMs and private content. Others will use these relays to send DMs to you. If you don't have it setup, you will miss DMs. DM Inbox relays should accept any message from anyone, but only allow you to download them.

Generally speaking, you only need 3 for reliability. One of them should be a personal relay to make sure you have a copy of all your messages. The others can be open if you want push notifications or closed if you want full privacy.

Good options are: - inbox.nostr.wine and auth.nostr1.com: anyone can send messages and only you can download. Not even our push notification server has access to them to notify you. - a personal relay to make sure no one can censor you. Advanced settings on personal relays can also store your DMs privately. Talk to your relay operator for more details. - a public relay if you want DM notifications from our servers.

Make sure to add at least one public relay if you want to see DM notifications.

Private Home Relays

Private Relays are for things no one should see, like your drafts, lists, app settings, bookmarks etc. Ideally, these relays are either local or require authentication before posting AND downloading each user\'s content. There are no dedicated relays for this category yet, so I would use a local relay like Citrine on Android and a personal relay on relay.tools.

Keep in mind that if you choose a local relay only, a client on the desktop might not be able to see the drafts from clients on mobile and vice versa.

Search relays:

This is the list of relays to use on Amethyst's search and user tagging with @. Tagging and searching will not work if there is nothing here.. This option requires NIP-50 compliance from each relay. Hit the Default button to use all available options on existence today: - nostr.wine - relay.nostr.band - relay.noswhere.com

Local Relays:

This is your local storage. Everything will load faster if it comes from this relay. You should install Citrine on Android and write ws://localhost:4869 in this option.

General Relays:

This section contains the default relays used to download content from your follows. Notice how you can activate and deactivate the Home, Messages (old-style DMs), Chat (public chats), and Global options in each.

Keep 5-6 large relays on this list and activate them for as many categories (Home, Messages (old-style DMs), Chat, and Global) as possible.

Amethyst will provide additional recommendations to this list from your follows with information on which of your follows might need the additional relay in your list. Add them if you feel like you are missing their posts or if it is just taking too long to load them.

My setup

Here's what I use: 1. Go to relay.tools and create a relay for yourself. 2. Go to nostr.wine and pay for their subscription. 3. Go to inbox.nostr.wine and pay for their subscription. 4. Go to nostr.watch and find a good relay in your country. 5. Download Citrine to your phone.

Then, on your relay lists, put:

Public Home/Outbox Relays: - nostr.wine - nos.lol or an in-country relay. - .nostr1.com

Public Inbox Relays - nos.lol or an in-country relay - .nostr1.com

DM Inbox Relays - inbox.nostr.wine - .nostr1.com

Private Home Relays - ws://localhost:4869 (Citrine) - .nostr1.com (if you want)

Search Relays - nostr.wine - relay.nostr.band - relay.noswhere.com

Local Relays - ws://localhost:4869 (Citrine)

General Relays - nos.lol - relay.damus.io - relay.primal.net - nostr.mom

And a few of the recommended relays from Amethyst.

Final Considerations

Remember, relays can see what your Nostr client is requesting and downloading at all times. They can track what you see and see what you like. They can sell that information to the highest bidder, they can delete your content or content that a sponsor asked them to delete (like a negative review for instance) and they can censor you in any way they see fit. Before using any random free relay out there, make sure you trust its operator and you know its terms of service and privacy policies.

@ 04ea4f83:210e1713

Digitales Geld ist nur Text, die ganze Zeit

Bei digitalem Geld geht es im Grunde nur um Zahlen in einem Hauptbuch. Die ganze Zeit über sind es die Zahlen, auf die es ankommt. Lange Zahlen sind einfach nur Zeichenketten im PC und diese werden als Nachrichten in einem Netzwerk, das durch Regeln gebildet wird, an gleichwertige Peers gesendet - das ist Bitcoin, das mit einem einzigartigen dezentralen Zeitstempel-Algorithmus kombiniert wird, der durch die Unfälschbarkeit von Energie gesichert ist. Das Ergebnis ist ein Bargeldnetzwerk mit einem festen, vorprogrammierten Zeitplan für die Geldschöpfung, das den ersten absolut knappen digitalen Inhabervermögenswert schafft.\ \ Diese revolutionären Ideen werden bleiben, genauso wie das Feuer, das Rad, die Elektrizität, das Smartphone, das Internet oder die Zahl Null. Technologie entwickelt sich weiter und was machen lebende Organismen? Sie können mutieren, genau wie Viren, und das hat mich zu dem Schluss gebracht, dass es auch in dieser Hinsicht eine Verbindung gibt und das obwohl Gigi bereits einige der vielen Facetten von Bitcoin beschrieben hat. Für mich ist die Grundlage die Abstraktion, dass Bitcoin nur die Summe aller Menschen ist, die Satoshis besitzen oder anderweitig mit dem Bitcoin-Netzwerk interagieren.\ \ Die Technologien werden in einem bestimmten Tempo angenommen. Allerdings gibt es immer frühe oder späte Entdecker von neuer Technologie. Aber was passiert, wenn es zu einer ernsthaften Bedrohung wird, wenn hartes Geld nicht adoptiert wird? Was passiert, wenn die Geschwindigkeit der Preiszunahme so hoch wird, dass es unmöglich ist, jemanden zu finden, der Satoshi in Fiat tauschen möchte? Was passiert, wenn die Hyperbitcoinisierung morgen beginnt? Was wäre, wenn es eine UpSideProtection™️ gäbe, die diesen Prozess noch mehr beschleunigt und dir Bitcoin zu einem Bruchteil seines wahren Wertes sichert?\ \ Wir alle wünschen uns einen sicheren Übergang, um den Krieg aufgrund einer scheiternden Dollar-Hegemonie zu vermeiden, und tatsächlich gibt es ein Rennen, um den Krieg zu vermeiden. Mein größtes Geschenk ist die Zeit, die ich ich investiere, und die monetäre Energie, die ich in Bitcoin spare, und da ich schon eine Weile dabei bin, sehe ich, dass meine Mitstreiter die gleiche Mission verfolgen. Aber das ist NICHT genug. Wir müssen skalieren. Schneller.\ \ Das Erstaunen über den  Kurzfilm der große Widerstand hat mich zu dem Schluss gebracht, dass wir alle Werkzeuge und Informationen in Form von Lehrern, Podcasts, Büchern und aufklärenden Videos bereits haben. Der Vorteil einer festen Geldmenge wird aber noch nicht von einer kritischen Masse verstanden, sondern nur von einer intoleranten Minderheit. Diese Minderheit wächst von Tag zu Tag. Ihre Inkarnationen sind die DCA-Armee, die Hodler der letzten Instanz, die unbeirrten Stacker, die Cyberhornets, die Memefactory™️ und Mitglieder der 21 Gruppe auf der ganzen Welt.\ \ Wir Bitcoiner sind räumlich getrennt, aber nicht in der Zeit. Getrennt in der Sprache, aber nicht in der Mission. Vereint müssen wir uns zu Wort melden, aufklären und Bitcoin wie einen Virus verbreiten.\ \ Niemand entscheidet, was Bitcoin für dich ist - dieser Virus des Geistes verfestigt sich in unbestechlichen Zahlen, die zu einer wachsenden Zahl an UTXOs in den Geldbörsen führen, nicht in negativen gesundheitlichen Auswirkungen. Bitcoin ist der Virus der Schuldenindustrie, der Virus, der im 21. Jahrhundert zur größten Definanzialisierung und Auflösung des Kredits führen wird. Da wir noch nicht in einer hyperbitcoinisierten Welt leben, müssen wir den Virus effektiver machen. Bitcoin muss mutieren, aber es ist nicht Bitcoin, der tatsächlich mutiert, sondern die Menschen, die ihn benutzen. Sie werden zu toxischen Maximalisten, die den Virus noch stärker verbreiten und alle Shitcoiner während ihrer Anwesenheit geistig infizieren oder argumentativ töten.\ \ Ich habe mich gefragt, wie wir eine Milliarde Menschen dazu ausbilden und überzeugen können, Bitcoin freiwillig zu nutzen und darin zu sparen, so dass sie Bitcoin als primäres Mittel zur Speicherung und Übermittlung von Werten in Raum und Zeit nutzen? Die Hyperbitcoinisierung braucht nur eine einzige, starke positive Rückkopplungsschleife um wirklich in Gang zu kommen, und diese Rückkopplung gibt es bereits, aber nicht in den Köpfen aller. Ab einer bestimmten Schwelle wird die Schwerkraft von Bitcoins gehärteten monetären Eigenschaften einfach zu hoch sein, als dass die Spieltheorie nicht zu dieser Rückkopplung führen würde, vor allem da Bitcoin im Jahr 2024 Gold in Punkto Knappheit übertrifft.\ \ Die Verbreitung der Idee einer festen dezentralen Geldmenge, die der Macht zentraler Kräfte entzogen ist, ist der Virus. Der Weg, das Spiel zu spielen, ist, Stacker zu stapeln, und Stacker stapeln Sats, wodurch die Geldmenge noch dezentralisierter wird und ein Verbot noch absurder wird. Sats sind endlich und unser Spiel ist es auch. Allein eine bestimmte Anzahl von einfachen Leuten, den Plebs, kann den Preis auf 1.000.000 EURO treiben.\ \ Letztendlich wird sich die Welt an das neue Gleichgewicht der Macht zugunsten des Individuums anpassen. Diese Idee in die Köpfe der Massen zu bringen, ist die wichtigste Aufgabe für 2023, die in das nächste Halving Mitte 2024 führt.\ \ Wir müssen unseren Reproduktionswert erhöhen, um die Akzeptanz zu steigern. Die Verwendung von Bitcoin als Zahlungsmittel und eine Kreislaufwirtschaft ist wichtig. Bildung ist wichtig. Apps und Anwendungsfälle sind wichtig. Die Kaufkraft, d.h. die Moskau Zeit, die sich in Richtung Mitternacht (00:00) bewegt, spielt eine Rolle, und all dies hängt zusammen.\ \ Aber wie genau können Plebs eine Milliarde Menschen überzeugen?\ \ Wie genau hat das Corona-Virus eine Milliarde Menschen infiziert?\ \ Peer-to-Peer.\ \ Erhebe deine Stimme, wer auch immer du bist, sprich über Bitcoin, werde aktiv und BUIDL oder lass uns einfach Spaß daran haben, arm zu bleiben und es genießen, jeden Tag bestohlen zu werden.\ \ Lass uns Yellow mehr Freizeit schenken und Bitcoin bis 100k+ aufkaufen und uns damit ins Stackheaven befördern.

"Don't stop believin' HODL on to that feelin' "

Der Rest wird in die unumstößliche Geschichte der Timechain eingraviert.

„Unter dieser Maske gibt es mehr als nur Fleisch. Unter dieser Maske ist eine Idee. Und Ideen sind kugelsicher."  Alan Moore, V wie Vendetta

⚡

Danke für deine Aufmerksamkeit .\ \ #GetShortFiat und #GetOnZero\ \ Es ist immer noch 60 Uhr. Sei weise und stapele unbeirrt. Man kann die Mathematik und Physik nicht austricksen.\ \ Wenn der Post dir Motivation zum Stapeln von Sats oder dem Stapeln von Stackern gemacht hat, freue ich mich, wenn du mir auch etwas beim Stapeln hilfst!

@ 04ea4f83:210e1713

Was ist ein Meme?

Bevor wir uns in die Materie vertiefen, sollten wir einen genaueren Blick auf die Begriffe werfen, mit denen wir es zu tun haben. Laut dem American Heritage Dictionary of the English Language ist ein Meme „eine Einheit kultureller Informationen, wie z. B. eine kulturelle Praxis oder Idee, die verbal oder durch wiederholte Handlungen von einem Geist zum anderen übertragen wird".

Der Begriff wurde von Richard Dawkins in seinem 1976 erschienenen Buch geprägt und ist eine Anspielung auf das Wort "Gen", die Einheit der biologischen Information, die sexuell von einem Organismus auf einen anderen übertragen wird.

Dawkins erkannte, dass kulturelle Informationen ähnlich wie biologische Informationen sind und sich genauso verbreiten und mutieren, wenn auch auf einer höheren Abstraktionsebene. Genau wie bei biologischen Informationen ist der ultimative Test für kulturelle Informationen das Überleben, und genau wie biologische Informationen müssen sie für die Umwelt geeignet sein, um sich zu verbreiten und am Leben zu gehalten zu werden.

Manche Ideen funktionieren einfach nicht, wenn sie fehl am Platz sind oder die Zeit nicht reif für sie ist. Sie werden schnell sterben, genau wie der sprichwörtliche Fisch auf dem Trockenen. Andere Memes funktionieren vielleicht eine Zeit lang, verblassen aber langsam durch allmähliche Veränderungen in der Umwelt oder brechen plötzlich durch die von ihnen ausgelösten destruktiven Rückkopplungsschleifen zusammen. Wie Gene verbreiten sich Meme langfristig nur dann, wenn sie für den Organismus und seine Umwelt von Nutzen sind.

„In der Wissenschaft der Ökologie lernt man, dass der Mensch nicht ein Organismus in einer Umwelt ist, sondern eine Organismus-Umwelt-Beziehung. Das heißt, ein einheitlicher Bereich des Verhaltens. Wenn man das Verhalten eines Organismus sorgfältig beschreibt, kann man das nicht tun, ohne gleichzeitig das Verhalten der Umwelt zu beschreiben... [...] Der Organismus ist nicht die Marionette der Umwelt, die von ihr herumgeschubst wird. Umgekehrt ist auch die Umwelt nicht die Marionette des Organismus, die vom Organismus herumgeschubst wird. Die Beziehung zwischen ihnen ist, um es mit John Deweys Worten zu sagen, transaktional."\ \ Alan Watts

Was hat das mit Bitcoin zu tun? Nun, du musst dich fragen, wie das Bitcoin-Netzwerk zustande kommt, und wenn du das tust, wirst du feststellen, dass Bitcoin sich nicht allzu sehr von den oben erwähnten Memen und Genen unterscheidet. Bitcoin ist ein instanziierter Computercode, ein digitaler Organismus, der die Menschheit dafür bezahlt, ihn am Leben zu erhalten, wie Ralph Merkle es so treffend formulierte. Die kumulative Arbeit, die in Bitcoins Timechain eingebettet ist, ist das, was Bitcoin real macht und was ihn von gewöhnlicher Information unterscheidet. Und von gewöhnlichen Computerprogrammen, was das betrifft. Genauso wie es einen Unterschied zwischen dir selbst und einem Ausdruck deiner DNA gibt, gibt es einen Unterschied zwischen dem Bitcoin-Code - den Memes, die er sich zu Nutze macht - und der realen Instanziierung von Bitcoin.

Das Bitcoin-Netzwerk instanziiert und validiert sich selbst alle 10 Minuten, Block für Block, wie ein Uhrwerk. Diese Blöcke sind die Informationseinheit, die übertragen wird, und ja, genau wie bei den Memen ist diese Information eine kulturelle Information. Die Tatsache, dass diese Information elektronisch übertragen wird, spielt keine Rolle; sie verkörpert immer noch den Kern der Bitcoin-Kultur, die Seele des Netzwerks. Und genau wie Memes wird diese Information durch wiederholte Aktionen von einem Knotenpunkt zum anderen übertragen. Und davor, von einem Geist zum anderen.

Im ökologischen Sinne handeln wir alle mit Bitcoin, und Bitcoin handelt mit uns. Wenn du von Bitcoin gehört hast, wenn du das Meme „21 Millionen" kennst, dann hat Bitcoin mit dir Geschäfte gemacht. Lange bevor du deine erste Bitcoin-Transaktion gemacht haben.

Memes und ihre Umgebung

Bitcoin sind Menschen, wenn es darauf ankommt. Ja, es ist Software, aber die Menschen müssen die Software ausführen und, was noch wichtiger ist, selbst entscheiden, was Bitcoin ist. Es gibt keine Autorität, wenn es um Bitcoin geht. So muss jeder für sich selbst herausfinden, was Bitcoin ist, und aus der Überschneidung der verschiedenen Standpunkte ergibt sich ein Konsens. Dies ist ein ständiger Prozess, denn es geht nicht nur darum, was Bitcoin derzeit ist, sondern auch darum, was Bitcoin sein könnte. Was Bitcoin sein sollte. Genau darum ging es im Blocksize War. Ein Kampf um die Seele von Bitcoin. Eine Meinungsverschiedenheit über die Zukunft und den ultimativen Zweck von Bitcoin. Ein Unterschied im memetischen Material, der letztendlich zu einer Spaltung des Protokolls führte, was wiederum zu einer Spaltung des Netzwerks und einer Spaltung der Kultur führte.

Aber auch ohne eine Spaltung, selbst wenn ein Konsens besteht, ist die Frage „was Bitcoin ist" nicht eindeutig zu beantworten.

Für dich mag das Lightning Network nicht wichtig sein, und es steht dir frei, eine Vor-SegWit-Version von Bitcoin zu betreiben. Für jemand anderen sind Dickbutts und Fürze auf der Blockchain vielleicht nicht wichtig, und er könnte sich entscheiden, eine Vor-Taproot-Version von Bitcoin zu verwenden (oder eine Version zu verwenden, die Ordnungszahlen (Ordinals) nicht respektiert). Bitcoin ist abwärtskompatibel, und Upgrades sind optional, gerade weil es keine Autorität gibt, die etwas vorschreibt.

So funktioniert Bitcoin, und so wird es immer funktionieren, weshalb Memes wichtig sind und warum es eigentlich durchweg Memes sind.

Um Bitcoin zu nutzen, muss man sich freiwillig entscheiden. Man muss zuerst von der Idee überzeugt werden, von der Idee, Sats zu akzeptieren, damit Fiat fallen zu lassen und Bitcoin zu erwerben. Erst wenn man davon überzeugt ist, dass elektronisches Bargeld mit einer (absolut) festen Menge nützlich sein könnte, wird man es akzeptieren oder damit sparen.

Das Meme „21 Millionen" kommt zuerst, und nachdem unsere Gehirne ausreichend von der Idee infiziert wurden, werden wir deshalb die Software starten, die die 21 Millionen ins Leben rufen.

Natürlich kommen manche Leute - ich glaube, die meisten - auf Umwegen zum Bitcoin. Du denkst, dass es sich um einen spekulativen Vermögenswert handelt, etwas, das existiert, um mehr Dollar zu verdienen, d. h. um mehr Papiergeld zu verdienen. Oder du entdeckst ihn über Online-Glücksspiele oder andere Wege, und auf diese Weise kommen sie zu ihren ersten Sätzen. Aber selbst wenn du auf Umwegen zu Bitcoin kommst, selbst wenn Bitcoin vor deiner Haustür ankommt, ohne dass du verstehst, womit du es zu tun hast, musst du lernen, Bitcoin selbstbestimmt zu nutzen, oder du wirst es nicht schaffen.

Bitcoin auf eine selbstsouveräne Art und Weise zu nutzen, bedeutet, dass du die Memes von Bitcoin absorbieren musst. Zum Beispiel musst du die „21 Millionen" übernehmen und ihnen zustimmen, sonst hast du keinen Bitcoin, sondern einen Shitcoin in den Händen. Bitcoin am Laufen zu halten bedeutet, Bitcoin auszuleben, was wiederum bedeutet, seine eigenen Schlüssel zu besitzen, seinen eigenen Knoten zu betreiben und den zentralen Konsensparametern zuzustimmen, die Bitcoin zu Bitcoin machen.

Mit der Zeit wird ein horizontaler Meme-Transfer stattfinden. Bitcoin wird auf dich abfärben. Du wirst nicht nur den Ideen ausgesetzt sein, die in Bitcoin eingebettet sind; nein, du wirst ein Teil davon sein und das Meme leben, indem du die Satoshi Tag für Tag und Block für Block hältst.

Oder du wirst es nicht. Wenn du mit den Ideen, die in den Konsensparametern von Bitcoin eingebettet sind, nicht einverstanden sind, hast du zwei Möglichkeiten: Du kannst dich abspalten oder unter dem Bitcoin Derangement Syndrom leiden. Man kann sich natürlich auch an die Umwelt anpassen und in Symbiose mit ihr leben, was bedeutet, sich mit dem in Bitcoin eingebetteten memetischen Material zu arrangieren - es zu akzeptieren und ihm langsam zuzustimmen.

Wenn man die zuvor skizzierte ökologische Sichtweise anwendet, bilden Bitcoin und die Bitcoiner selbst den Organismus-Umwelt und beeinflussen sich gegenseitig in 10-Minuten-Intervallen. Das Knifflige daran ist, dass Bitcoin sowohl Organismus als auch Umwelt ist, genau wie wir selbst. Das Bitcoin-Meme lebt in unseren Gehirnen und unsere Vorstellung davon, was Bitcoin ist - und was es sein sollte - ändert sich mit der Zeit. Die ökonomische Erweiterung von uns - unsere Sats - leben in der Umgebung, die Bitcoin ist, eine Umgebung, die wir individuell und kollektiv hervorbringen.

Wir formen unsere Werkzeuge, und unsere Werkzeuge formen uns. Und wir benutzen unsere Werkzeuge, um unsere Umwelt zu formen, die natürlich auch uns formt. Kultur ist das Ergebnis dieser gegenseitigen Beeinflussung, und was ist Kultur anderes als eine Vielzahl von Memen?

Bei Bitcoin haben wir es mit einem unglaublichen meinungsbildenden Werkzeug zu tun, das eng mit uns verwoben ist. Ein Werkzeug, das ein Umfeld schafft, das lächerlich schwer zu ändern ist. Ich würde sogar so weit gehen zu sagen, dass einige Aspekte dieser seltsamen Meme-Werkzeug-Organismus-Umwelt-Schleife unmöglich zu ändern sind, da dies die Identität von Bitcoin und Bitcoinern gleichermaßen zerstören würde.

Für mich wird Bitcoin immer durch 21ismus definiert werden, auch wenn ich der letzte Mensch wäre, der an dieses Meme glauben würde. Anstelle dessen würde ich lieber auf dem Hügel von 21 Millionen sterben - allein und in Armut, mit dem Node in der Hand und zwölf Worten in meinem Kopf - als einer Erhöhung des Bitcoin-Angebots um 1 % zuzustimmen. (Buchvorschlag: Mandibles)

Es gibt diejenigen, die diese unveränderliche Umgebung akzeptieren, und diejenigen, die sie ablehnen, was natürlich zu einer Spaltung der Kultur führt.

Kulturelle Spaltungen

Wir erleben zweifelsohne eine Art Kulturkrieg. Links gegen Rechts, Rot gegen Schwarz, Based gegen Woke, Blue Bird gegen Purple Bird und Furries gegen normale Menschen. Es ist schwer, die Bruchlinien auszumachen, die diesem Krieg zugrunde liegen. Einige glauben, dass es auf Individualismus gegen Kollektivismus hinausläuft. Andere sehen es als Kapitalismus vs. Marxismus, selbstregulierende Ordnung vs. zentrale Planung. Wieder andere spekulieren, dass dieses Chaos mit dem Rückgang des religiösen Glaubens zusammenhängt, der eine Folge der nietzscheanischen Ermordung Gottes ist.

Alle diese Gründe mögen zutreffend oder teilweise zutreffend sein, aber für mich als Bitcoiner - als jemand, der die Graphen des "WTF geschah 1971" viele Male bestaunt hat - ist es schwer, etwas anderes als den Notstand des Fiat-Geldes als den Hauptgrund für das Chaos, das wir erleben, zu benennen. Für mich scheint es offensichtlich, dass diese verrückten Zeiten ein Ergebnis des Fiat-Geldsystems und der wirtschaftlichen sowie memetischen Konsequenzen sind, die es mit sich bringt. Es ist ein System, das völlig von der Realität abgekoppelt ist, ein künstliches und hochpolitisches Umfeld, das, ob wir es erkennen oder nicht, das wirtschaftliche Betriebssystem unserer Welt ist. Für mich lässt sich die Bruchlinie der Gesellschaft am besten als „Bitcoin vs. Fiat" zusammenfassen.

Seit 50 Jahren leben wir die Idee des Fiat-Geldes aus. Das Meme, dass die Art des Basisgeldes keine Rolle spielt, die hartnäckige Überzeugung, dass „wir es uns selbst schulden". Wir scheinen zu glauben, dass unsere kollektive Zukunft ein magischer goldener Topf ist - scheinbar ohne Boden -, aus dem wir uns immer und immer wieder etwas leihen können.

Ich glaube, dass wir uns in der Endphase des großen Fiat-Experiments befinden. Einmal mehr haben die arroganten Könige dieser Welt beschlossen, Gott zu spielen und sich in Kräfte einzumischen, die größer sind als sie, größer als wir. Wieder einmal müssen wir feststellen, dass das Drucken von Geld keinen wirklichen Wert schafft. Einmal mehr wird sich die Gesellschaft wandeln oder ganz zusammenbrechen, wie es in Ägypten, Rom und in vielen anderen Kulturen vor der unseren geschah. Und einmal mehr wird sich die Natur durchsetzen, indem sie Verwüstung anrichtet und alles ausrottet, was nicht mit ihr übereinstimmt. Seien es Ideen oder anderes.

„Als es nun an Geld gebrach im Lande Ägypten und in Kanaan, kamen alle Ägypter zu Josef und sprachen: Schaffe uns Brot! Warum lässt du uns vor dir sterben? Denn das Geld ist zu Ende."\ \ Mose 47:15

Diesmal ist das Fiat-Experiment jedoch nicht lokal begrenzt. Es ist nicht das Geld eines einzelnen Landes, das versagt, sondern das Meme des Fiat-Geldes selbst.

Geld drucken vs. das Geld in Ordnung bringen

Die Erkenntnis der Bedeutung des Geldes sowie der moralischen und kulturellen Implikationen der Natur des Geldes - und der Ethik der Geldproduktion - hat mein Weltbild unwiderruflich verändert. Als ich erkannte, dass Gelddrucken nichts anderes als eine Umverteilung von Reichtum ist und dass eine zentral geplante Umverteilung von Reichtum eine unmögliche Aufgabe ist - nicht nur rechnerisch, sondern auch moralisch -, dämmerte mir, dass Konfiszierung durch Inflation und andere Formen der unfreiwilligen Umverteilung nichts anderes ist als Diebstahl auf Umwegen. Das Fiat-System ist ein System der Sklaverei, und nein, das ist keine Übertreibung.

Aber hier ist die gute Nachricht: Bitcoin schafft hier Abhilfe.

Das ist unsere Meme-Welt, alle anderen leben nur darin.

Es gibt eine bestimmte Ethik, die in Bitcoin eingebettet ist, und es ist diese Ethik, die den Grundstein für die Meme bildet, die wir entstehen und sich verbreiten sehen. Wenn ich es in einem Satz zusammenfassen müsste, dann wäre es dieser: „Du sollst nicht stehlen." Wenn ich es in einer Zahl zusammenfassen müsste, dann wäre es natürlich 21 Millionen.

Die Motivation hinter der Erschaffung von Bitcoin ist zweifelsohne politisch, wie „Kanzlerin am Rande der zweiten Bankenrettung" und verschiedene Kommentare von Satoshi zeigen. So stimmte Satoshi zwar der Aussage zu, dass „sie in der Kryptographie keine Lösung für politische Probleme finden werden", aber er erwähnte auch, dass „wir eine wichtige Schlacht im Wettrüsten gewinnen und ein neues Territorium der Freiheit gewinnen können". Man beachte die Worte, die in dieser Aussage verwendet werden: ein Gebiet (Umfeld) der Freiheit (im Gegensatz zur Sklaverei).

Ich würde argumentieren, dass „eine große Schlacht gewinnen" eine Untertreibung ist, und ich würde auch argumentieren, dass die ursprüngliche Behauptung falsch ist, aber ich werde darauf zurückkommen.

Doch auch ohne diese Kommentare, selbst wenn die in den Genesis-Block eingebettete Botschaft „ooga chaka ooga ooga ooga chaka" lauten würde, wäre Bitcoin immer noch politisch. Ja, das daraus resultierende System ist unpolitisch, genau wie der Sonnenaufgang unpolitisch ist, aber der Akt der Schaffung von bitcoin ist ein politischer Akt. Er ist eine Aussage, eine Manifestation bestimmter Ideen, von Qualitätsmemes.

Vergleiche die in Bitcoin eingebettete Ethik (festes Angebot, keine erzwungene Umverteilung, kein kostenloses Mittagessen, keine Rettungsaktionen) mit der Ethik des Fiat-Geldes (endloses Angebot, zentral geplante Umverteilung, Rettungsaktionen für Freunde, alles ist erfunden) - oder, noch drastischer, mit der „Ethik" der Shitcoins, die nur Fiat-Geld auf Steroiden ist (jeder kann sein eigenes Geld drucken, nichts ist wichtig, Rugpulls sind lustig und Dickbutts sind im Grunde die Mona Lisa).

Ist es eine Überraschung, dass die Kultur rund um diese Phänomene so unterschiedlich ist? Oder ist „du wirst nichts besitzen und du wirst glücklich sein" einfach eine Folge des Mems, das Fiat-Geld ist? Ist der kulturelle Unterschied zwischen Bitcoinern und Shitcoinern ein natürliches Ergebnis der Meme, die in den verschiedenen Organismus-Umgebungen eingebettet sind und von diesen hervorgebracht werden?

Im Klartext bedeutet das Meme des Fiat-Geldes - die Idee, dass wir Geld aus dem Nichts erschaffen können und sollten - einfach zu sagen: „Ich weiß besser als der Markt, wie man Geld verteilt", was bedeutet, dass ich besser als alle anderen weiß, was gut und was schlecht ist, was wertvoll ist und was nicht, was notwendig und was überflüssig ist.

Die Frage, die das Fiat-System beantwortet, ist die folgende: Wer darf Geld fälschen und wie viel? Und wer darf Zugang zu Geld haben, und wer nicht? Die Antwort ist politisch und wird mit Gewalt durchgesetzt.

Das Bitcoin-System beantwortet dieselben Fragen, und die Antworten sind ebenso einfach wie ethisch: Niemand darf Geld fälschen, und jeder kann darauf zugreifen. Keine Ausnahmen.

Dies sind zwei sehr unterschiedliche Ideen, zwei sehr unterschiedliche Memes. Die eine wird im Fiat-System umgesetzt, die andere im Bitcoin-System. Das eine bricht aus den Nähten, das andere tuckert vor sich hin und wächst wirtschaftlich, rechnerisch und memetisch - alle 10 Minuten.

Bitcoin vs. Gold

Wenn es darum geht, die Grundursache vieler unserer Übel zu identifizieren, hatten die Goldanhänger (größtenteils) die richtige Idee. Aber sie hatten keine Möglichkeit, ihre Ideen auf sinnvolle und effektive Weise umzusetzen, die in der vernetzten Welt des 21. Das Meme des „gesunden Geldes" ist das richtige Mem, aber ohne eine Möglichkeit, dieses Meme effizient umzusetzen, hat das Meme keine Möglichkeit, sich in der Bevölkerung zu verbreiten.

So sieht es aus, liebe Goldfresser: Wir werden nicht zu einem Goldstandard zurückkehren. Gold hat in der Vergangenheit versagt, und es würde auch in der Zukunft versagen. Die Nützlichkeit des „Goldstandard"- Memes ist zu einem Ende gekommen. Das Überbleibsel seiner glorreichen Vergangenheit wird nur noch in der Linguistik zu finden sein.

„Warum", fragst du dich? Nun, zunächst einmal verbietet der physische Körper des Goldes die Teleportation, d. h. die elektronische Übertragung von Gold. Er verbietet die Unsichtbarkeit, d. h. die plausible Abstreitbarkeit des Besitzes. Bitcoin kann sofort teleportiert und perfekt versteckt werden. Man kann ihn im Kopf behalten, und niemand kann wissen, ob man Bitcoin tatsächlich besitzt oder nicht. Gold wird allein aus logistischen Gründen immer in Tresoren zentralisiert sein. Bitcoin muss das nicht sein. Gold wird sich immer mit einer bestimmten Rate aufblähen, da eine unbekannte Menge noch unter der Erde (und im Weltraum) liegt. Die Menge, die sich über der Erde befindet, ist ebenfalls unbekannt, da der weltweite Goldvorrat nicht einfach überprüft werden kann.

Im Gegensatz dazu ist Bitcoin absolut knapp und perfekt überprüfbar. Alle 10 Minuten wird der Gesamtvorrat an Bitcoin geprüft. Alle 10 Minuten wird der Emissionsplan überprüft. Alle 10 Minuten werden Milliarden von Sats endgültig und elektronisch, d.h. mit Lichtgeschwindigkeit, abgerechnet. Eine echte, physische Abrechnung. Global und sofort, ohne große Kosten oder Reibungsverluste. Alle 10 Minuten.

Das Gold-Meme wird sich noch eine Weile halten, und das ist auch gut so. Die Menschen sind nostalgisch, besonders wenn sie in ihren Gewohnheiten verhaftet sind. Wie bei wissenschaftlichen Revolutionen wird sich die monetäre Revolution, die derzeit im Gange ist, wahrscheinlich langsam verbreiten: eine Beerdigung nach der anderen.

Ich glaube jedoch, dass Bitcoin die Macht hat, die Köpfe und Herzen der Menschen sehr schnell zu gewinnen, wenn diese Köpfe offen oder kulturell angepasst genug sind; oder wenn die Veränderung in ihrem Umfeld drastisch genug ist.

Allmählich, dann plötzlich.

Politik vs. Kultur

Kehren wir zu der Behauptung zurück, dass "du in der Kryptographie keine Lösung für politische Probleme finden werden". Ich habe bereits erwähnt, dass ich dem nicht zustimme, und hier ist der Grund. Politik ist der Kultur nachgelagert, und Kryptographie im Allgemeinen (und Bitcoin im Besonderen) verändert die Kultur.

Das sollte jedem außer dem blindesten Beobachter des Bitcoin-Bereichs sonnenklar sein. Die Kultur rund um Bitcoin ist durchdrungen von Verantwortung und Selbsteigentum („besitze deine eigenen Schlüssel" & „nicht deine Schlüssel, nicht dein Bitcoin"), Verifizierung und Schlussfolgerungen aus ersten Prinzipien ("vertraue nicht, verifiziere"), langfristigem Denken und Sparen für die Zukunft ("bleibe bescheiden, staple Sats"), sowie einem Fokus auf harte Arbeit, Integrität, Wahrheit und sichtbare Ergebnisse ("Proof-of-work, der Arbeitsnachweis").

Satoshi erkannte in wahrer Cypherpunk-Manier, dass Memes implementiert werden müssen, um sich möglichst effizient zu verbreiten, weshalb er sich hinsetzte und den Code schrieb. Es war auch der erste Test für die Tauglichkeit seiner Ideen, wie er in einem seiner vielen Forenbeiträge erwähnte: „Ich musste den ganzen Code schreiben, bevor ich mich selbst davon überzeugen konnte, dass ich jedes Problem lösen kann, und dann habe ich das Whitepaper geschrieben."

Das ist der Arbeitsnachweis, genau da. Das ist Anti-Fiat. Nicht nur darüber reden, sondern es auch tun. Mit gutem Beispiel vorangehen. Nicht nur über die Ideen spekulieren, die man im Kopf hat, die Memes, die man in der Welt verbreitet sehen möchte, sondern sie auch umsetzen. Das heißt, sie an der Realität zu messen.

„Lass deine Memes keine Träume sein."

Satoshi (paraphrasiert)

Ist es eine Überraschung, dass sich Bitcoin in den Bereichen „gesunde Ernährung", „gesunde Landwirtschaft", „freie Meinungsäußerung und Menschenrechte ausbreitet? Dass Bitcoin schnell und einfach von Menschen verstanden wird, die buchstäblich nahe am Boden sind, verbunden mit der grundlegenden Realität der Dinge? Ist es eine Überraschung, dass Bitcoin von denjenigen genutzt und verstanden wird, die es am meisten brauchen? Von denjenigen, die in Ländern leben, in denen das Geld versagt? Von denjenigen, die vom Fiat-System abgelehnt werden?

Das sollte keine Überraschung sein. Einige Kulturen haben eine natürliche Überschneidung mit der Bitcoin-Kultur, und es sind diese Kulturen, die Bitcoin zuerst annehmen werden. Frühe Beispiele sind die Cypherpunk-Kultur sowie die Kulturen rund um die österreichische Wirtschaft, den Libertarismus und das muslimische Finanzwesen. Wenn diese Kulturen Bitcoin annehmen, wird Bitcoin seinerseits diese Kulturen annehmen und dich beeinflussen. Ein für beide Seiten vorteilhafter Einfluss, wie er für alles, was langfristig überlebt, erforderlich ist, und wie er für die Symbiose, die die Natur darstellt, Standard ist. Der Organismus und das Umfeld, das durch die orangefarbene Münze und ihre Besitzer geschaffen wird, will überleben. Bitcoin: das egoistische Meme.

Natürlich gibt es auch Fiat-Meme. Es ist das, was unsere Kultur in den letzten 50 Jahren geprägt hat: „Fake it till you make it" und „YOLO" kommen mir in den Sinn, was interessanterweise die moderne Version der keynesianischen Idee ist, dass wir auf lange Sicht alle tot sind. Ist es verwunderlich, dass ein Umfeld, das durch falsches Geld geschaffen wurde, zu falschem Essen, falschen Körpern, falscher Gesundheit, falscher Medizin, falschen Beziehungen, falschen Experten und falschen Menschen führt?

Diejenigen, die an der Spitze der Fiat-Pyramide sitzen, sprechen von „nutzlosen Essern" und versuchen uns davon zu überzeugen, dass wir nichts besitzen müssen, aber trotzdem glücklich sein werden. Man muss sich über den Slogan wundern: „Du wirst nichts besitzen und du wirst glücklich sein".

„Du wirst ein glücklicher kleiner Sklave sein", heißt es in diesem Meme. Jemand hat beschlossen, dass Glück das ultimative Ziel ist, das es zu erreichen gilt, und du (und nur du) weißt, wie du es für dich erreichen können.

„Glück"

Als ob Glück das eigentliche Ziel wäre, das A und O, der Grund für unsere Existenz. Was ist mit dem Streben nach etwas Sinnvollem, etwas, das schwer ist, etwas, das Opfer erfordert, das Schmerz und Leid mit sich bringt?

\ „Jeder Mensch ist glücklich, bis das Glück plötzlich ein Ziel ist."

Tame Impala

Oder was ist mit der Aussage von Lagarde, dass „wir glücklicher sein sollten, einen Arbeitsplatz zu haben, als dass unsere Ersparnisse geschützt sind?" Das ist Ausdruck eines bestimmten Memes, das sich in ihrem Kopf festgesetzt hat, des Mems, dass Arbeitsplatzsicherheit die meisten anderen Bedürfnisse übertrumpft und dass normale Menschen kein Vermögen anhäufen müssen. Schlimmer noch: Es suggeriert, dass es völlig in Ordnung ist, das zu stehlen, was normale Menschen durch fleißige Arbeit im Laufe ihres Lebens angespart haben.

Wir sollte glücklicher sein einen Job zu haben als das unsere Erparnisse geschützt werden. Christine Largarde Präsidentin der ECB, Oktober 2019

Es gibt einen Grund, warum wir vom „Rattenrennen" oder dem „Hamsterrad" sprechen und warum dieser Teil unserer Kultur in Kunst und Film so stark kritisiert wird. Um Tyler Durden zu zitieren: „Die Werbung bringt uns dazu, Autos und Klamotten zu jagen, Jobs zu machen, die wir hassen, damit wir Scheiß kaufen können, den wir nicht brauchen. Wir sind die mittleren Kinder der Geschichte, Mann. Wir haben keinen Sinn und keinen Platz. Wir haben keinen Großen Krieg. Keine Weltwirtschaftskrise. Unser großer Krieg ist ein spiritueller Krieg... unsere große Depression ist unser Leben. Wir sind alle durch das Fernsehen in dem Glauben erzogen worden, dass wir eines Tages alle Millionäre, Filmgötter und Rockstars sein werden. Aber das werden wir nicht. Und wir lernen diese Tatsache langsam kennen. Und wir sind sehr, sehr wütend."

Ich glaube jedoch nicht, dass die Menschen wütend sind. Ich glaube, dass die meisten Menschen deprimiert und nihilistisch sind. Sie sehen keinen Ausweg, sie sind hoffnungslos und haben sich mit ihrer Position im System abgefunden - ob bewusst oder unbewusst.

Nichts zeigt die Plackerei des Fiat-Rattenrennens besser als der kurze Animationsfilm „Happiness", der eine visuelle Reise durch die unerbittliche Suche des Menschen nach Erfüllung in der modernen Welt darstellt. Er setzt in Bilder um, was viele Menschen nicht in Worte fassen können. Hilflosigkeit, Sucht, Hoffnungslosigkeit. Eine Krise des Selbst, eine Krise des Sinns. Das Fehlen einer hoffnungsvollen Vision für die Zukunft.

„Ehrlich gesagt, ist es ziemlich deprimierend", so ein 44-jähriger Arbeiter, der allein im Wald festsitzt. „Ich habe versucht, einen Gedanken zu formulieren, ihn auszudrücken, ohne zusammenzubrechen und zu weinen. Aber ich bin mir nicht sicher, ob ich ihn weitergeben kann, ohne zu weinen."

„Mein Problem, einer der Gründe, warum ich hierher kommen wollte, war also, dass ich versuchen wollte, über den neuen Aspekt meines Lebens nachzudenken. Mit anderen Worten: nach den Kindern."

„Ein Mensch kann eine Menge Dinge ertragen, für jemanden, den er liebt. Die gleichen Dinge nur für sich selbst zu ertragen, ist nicht so einfach. Ich bin Elektriker. Man könnte meinen, das sei nicht so schwer, aber es sind viele sich wiederholende Aufgaben. Ich weiß, dass jeder seine eigene Arbeit hat, ich weiß, dass das einfach der Lauf der Welt ist. Aber für mich ist der Gedanke, dass ich weitere 15 Jahre meines Lebens damit verbringen muss, auf die Wochenenden zu warten, einfach eine Qual. Einfach nur die banale Qual des Ganzen..."

Schau dir bei Möglichkeit diesen Clip an. Es ist eine Sache, über das Meme des Rattenrennens zu theoretisieren; es ist eine andere Sache, einem erwachsenen Mann zuzusehen, der weinend zusammenbricht, nachdem er über sein Leben, das System, in das er eingebettet ist, und die Zukunft, die dieses System für ihn bereithält, nachgedacht hat. Nachdem er sich die Tränen weggewischt hat, spekuliert er darüber, was der Grund für seine depressive Stimmung sein könnte: „An diesem Ort kenne ich die Regeln. Es ist das Leben außerhalb dieses Ortes, das mich zum Weinen bringt."

Das ist es, nicht wahr? Regeln und Regeländerungen. Wenn du jemanden zutiefst deprimieren wollen, änderst du die Regeln, und zwar häufig. Zwingen du sie, etwas Sinnloses zu tun. Ändere die Regeln willkürlich. Das ist es, was die Menschen wirklich demoralisiert: in einem System willkürlicher Regeländerungen gefangen zu sein. Keine Hoffnung auf Stabilität und kein Ausweg.

Der Dritte Weltkrieg wird ein Guerilla-Informationskrieg sein, bei dem es keine Trennung zwischen militärischer und ziviler Beteiligung gibt. - Marshall McLuhan

Das Meme ist die Nachricht.

"Weißt du, jetzt habe ich es endlich verstanden. Über den Unterschied zwischen einem echten Krieg und einem globalen Guerillakrieg. Denn was wir jetzt haben, ist kein konventioneller Krieg mit scharfen Waffen. Mit militärischer Ehre, militärischen Rängen, militärischer Aktivität... Das ist ein Kulturkrieg. Wir haben die Unruhen. Wir haben die Unordnung. Und jetzt weiß ich wirklich, wie das funktioniert. Wenn die Unruhen vorbei sind, kann man nicht mehr sagen: „Ich habe mit Stolz gedient. Es spielt keine Rolle, auf welcher Seite man steht. Denn die Unruhen sind ein Krieg gegen den Stolz. Es ist ein Krieg gegen die Moral der Menschen. Man kann dem Feind nicht als Gleicher gegenübertreten. Jeder lebt im Schatten. Es ist immer verdeckt. Es ist immer gefälscht. Er ist immer erfunden. Und es kann keine Geschichte darüber geschrieben werden, weil alles abgeschottet ist."\ \ Bruce Sterling

Für die Geldpolitik gibt es im Fiat-System keine Regeln. „Die Regeln sind erfunden, und die Punkte sind egal", um Drew Carey zu zitieren. Die Realität hat Regeln, und wenn ein Fiat-System erst einmal aus dem Ruder gelaufen ist, dann ist es die Realität, die die Konsequenzen zieht, nicht das Fiat-System selbst.

Das Fiat-System ist kaputt; sein Geld ist wertlos; seine Kultur ist deprimiert und hoffnungslos. Wenn die Politik der Kultur nachgelagert ist, ist es dann eine Überraschung, dass unsere Politik größtenteils eine Clownshow ist, die nur auf Äußerlichkeiten und kurzfristige Ziele ausgerichtet ist? Wo gibt es Hoffnung in der hoffnungslosen Welt des fiat everything? Kaputte Ideen führen zu kaputten Umgebungen, die wiederum zu kaputten Organismen führen. Ist der Mensch erst einmal kaputt, wird er nicht in der Lage sein, seine Umwelt auf eine für alle Seiten vorteilhafte Weise zu verändern. Ganz im Gegenteil. Er wird in einer Abwärtsspirale aus Verzweiflung und Zerstörung feststecken und versuchen, „um jeden Preis" zu tun, was nötig ist.

Ohne Bitcoin sind die Aussichten für unsere Zukunft düster. Ohne Bitcoin hast du zwei Möglichkeiten: die schwarze Pille des Pessimismus oder das Soma des Nihilismus.

Es gibt einen Grund, warum die Leute sagen, dass Bitcoin Hoffnung ist.

Schwarze Pille vs. Orange Pille

Bitcoin ist Hoffnung, weil die Regeln von Bitcoin bekannt und stabil sind. Das Bitcoin-System ist wahnsinnig zuverlässig, funktioniert wie ein Uhrwerk, mit Regeln, die bekannt und in Stein gemeißelt sind. Es ist eine Umgebung mit eisenharten Zwängen, die ohne Herrscher durchgesetzt werden.

Es ist nicht nur das Gegenteil des Fiat-Systems, sondern auch sein Gegengift. Es ist nicht nur ein Rettungsboot, in das jeder einsteigen kann, der in Not ist, sondern auch ein Heilmittel, das Sinn und Optimismus gibt, wo es vorher keinen gab.

Es ist leicht, depressiv zu werden, wenn man die Übel des Fiat-Systems erkannt hat. Viele Bitcoiner, die heute von Optimismus erfüllt sind, waren hoffnungslos und fatalistisch, bevor sie die orangefarbene Pille schluckten. Viele Menschen sind es immer noch, Lionel Shriver und die meisten Goldfresser eingeschlossen.

Aber man muss bereit sein. Man kann sich nur selbst eine orangefarbene Pille geben, wie man sagt. Niemand kann dir Bitcoin aufzwingen.

Du müsstest eine Erleuchtung haben, dieselbe Erleuchtung wie unser 44-jähriger Elektriker im Wald, der über sein Leben nachdenkt. Kurz nach seinem Zusammenbruch und seinem Monolog darüber, dass er im Rattenrennen feststeckt, kommt er zu einer plötzlichen Erkenntnis: „Ich muss etwas ändern. Es ist nicht die Welt, die sich ändern muss. Es bin ich, der sich ändern muss. Es ist meine Einstellung zum Leben."

Ja. Was für ein Chad.

Das ist buchstäblich die Funktionsweise von Bitcoin.

Fiat Denkweise vs. Bitcoin Denkweise

\ Das Fiat-System wird nicht einfach verschwinden, und es wird auch nicht still und leise verschwinden. Zu viele Menschen sind immer noch mit dem Gedanken an leicht verdientes Geld infiziert, arbeiten in Scheißjobs und führen ein Fiat-Leben. Der Tod des Fiat-Organismus ist jedoch unausweichlich. Er ist selbstzerstörerisch, und wie alle Tiere, die in die Enge getrieben werden und am Rande des Todes stehen, wird er in einem letzten Versuch, das Unvermeidliche zu verhindern, um sich schlagen.

Piggies von artdesignbysf

„Unser großer Krieg ist ein spiritueller Krieg", wie Tyler Durden es so treffend formulierte. Und wir sind mittendrin in diesem Krieg.

Mit jedem Tag wird es offensichtlicher, dass dies ein geistiger Krieg ist. Ein Zusammenprall von Ideen, ein Kampf der unterschiedlichen Weltanschauungen.

Selbst der letzte Boss von Bitcoin, Augustin Carstens, weiß, dass dies ein Krieg ist. Warum sonst würde er, die Verkörperung des Fiat-Standards, im Fernsehen auftreten und Folgendes sagen?

„Vor ein paar Jahren wurden Kryptowährungen als Alternative zu Papiergeld dargestellt. Ich denke, diese Schlacht ist gewonnen. Eine Technologie macht noch kein vertrauenswürdiges Geld."

Augustin Carstens

Wenn wir uns nicht in einem memetischen Krieg befänden, warum wäre es dann notwendig zu erklären, dass eine Schlacht gewonnen wurde?

Wenn wir uns nicht mitten in einem spirituellen Krieg befinden würden, warum würde Christine Lagarde, eine Person, die wegen Fahrlässigkeit und Missbrauchs öffentlicher Gelder verurteilt wurde - eine Person, die jetzt Präsidentin der Europäischen Zentralbank ist - öffentlich erklären, dass wir Bitcoin auf globaler Ebene regulieren müssen, denn „wenn es einen Ausweg gibt, wird dieser Ausweg genutzt werden?"

Warum würde Stephen Lynch behaupten, dass Bitcoin „auf Null gehen wird, wenn wir ein CBDC entwickeln, das den vollen Glauben und Kredit der Vereinigten Staaten hinter sich hat?"

Warum würde Neel Kashkari, verrückt wie er ist, vor eine Kamera treten, um das Mem zu verbreiten, dass „es unendlich viel Bargeld in der Federal Reserve gibt", in der Hoffnung, dass diese Aussage das Vertrauen in das zusammenbrechende Fiat-System stärken würde?

Es ist fast unmöglich, sich diese Interviews anzusehen, ohne den Kopf zu schütteln. Glauben diese Menschen wirklich, was sie sagen? Ist es Böswilligkeit oder ist es Unwissenheit? Oder ist es einfach ein Auswuchs der verzerrten Weltsicht des Fiat-Verstandes? Sind diese Menschen nicht mehr zu retten, oder könnte Bitcoin sie sogar demütigen und sie auf den Pfad der Verantwortung und der Finanzdisziplin bringen?

Wie auch immer die Antwort lauten mag, die bloße Existenz von Bitcoin ist eine Beleidigung für ihr Denken, oder für jedes Fiat-Denken, was das betrifft. Bitcoin setzt die Idee außer Kraft, dass Geld vom Staat geschaffen werden muss. Seine Architektur sagt: „Jeder sollte Zugang zum Geldsystem haben". Sein Design sagt: „Wir sehen, was ihr getan habt, Fiat-Leute, und wir werden dem ein Ende setzen."

„Die Existenz von Bitcoin ist eine Beleidigung für den Fiat-Verstand."

\ Es ist ironisch, dass das, was die meisten Fiat-Leute zuerst sehen, die Schlachtrufe der Bitcoiner sind, die „HODL!" schreien und „wir werden euch obsolet machen" von den Dächern schreien. Du übersiehst die tiefere Wahrheit dieser Memes, die Tatsache, dass diese Meme der tiefen Überzeugung entspringen, dass ein mathematisch und thermodynamisch gesundes System einem politischen System vorzuziehen ist. Sie hören weder das Brummen der ASICs, noch achten sie auf die gültigen Blöcke, die unaufhörlich eintreffen. Alle 10 Minuten wird leise geflüstert: „Du sollst nicht stehlen."

Das laute und prahlerische Oberflächenphänomen lässt sich leicht ins Lächerliche ziehen und abtun. Der zutiefst technische, wirtschaftliche und spieltheoretische Organismus, der die 21 Millionen zustande bringt, nicht so sehr. Beide sind im Wachstum begriffen. Beide sind miteinander verwoben. Das eine kann ohne das andere nicht existieren.

Fiat-Selbst vs. Bitcoin-Selbst

\ Beim ersten Kontakt wird der Bitcoin von den meisten abgetan. In einer Welt, die vom Fiat-Standard beherrscht wird, sind die meisten Menschen nicht in der Lage, die orangefarbene Münze zu verstehen, wenn sie zum ersten Mal über sie stolpern. Ich denke, man kann mit Sicherheit sagen, dass die meisten Bitcoiner es nicht sofort „verstanden" haben. Ich habe es anfangs sicherlich nicht verstanden.

Die Reise vieler Bitcoiner lässt sich wie folgt zusammenfassen:

1. Was zum Teufel ist das?
2. Was zum Teufel ist das?
3. Was zur Hölle?
4. Die Scheiße?
5. Scheiße...
6. All in.

Der Prozess des Verstehens und der Annahme von Bitcoin ist der Prozess des Verlassens deines Fiat-Selbst hinter sich. Man muss die Fiat-Memes aus dem Kopf bekommen und die Bitcoin-Memes hineinlassen. Du musst dein Fiat-Selbst ausbrennen und dein Bitcoin-Selbst aufbauen. Tag für Tag, Aktion für Aktion, Block für Block.

Indem du am System der Fiat-Schuldensklaverei teilnimmst, verstärkst du das Meme der sofortigen Befriedigung, der Diskontierung der Zukunft für die Gegenwart, des falschen Geldes und des kurzfristigen Denkens. Indem du am Bitcoin-System teilnimmst, stärkst du das Mem des gesunden Geldes, des unelastischen Angebots, des langfristigen Denkens, der Verantwortung und der unveräußerlichen Eigentumsrechte.

„Man kann die Revolution nicht kaufen. Man kann die Revolution nicht machen. Du kannst nur die Revolution sein. Sie ist in deinem Geist, oder sie ist nirgendwo." - Ursula K. Le Guin

Verstehe mich nicht falsch. Es ist nichts falsch daran, in den Fiat-Minen zu arbeiten und bescheiden Sats zu stapeln. Es ist eines der wichtigsten Dinge, die du tun kannst. Das Stapeln von Sats gibt dir Freiheit, Kontrolle und Selbstständigkeit. Es ermöglicht dir, sich in eine Position der Stabilität und Stärke zu manövrieren, und ehe du dich versiehst, wird der einfache Akt des demütigen Stapelns und der Liebe zu deinem zukünftigen dich selbst verändern.

Der wahre Kampf ist ein persönlicher Kampf. Den Drang zu unterdrücken, etwas umsonst haben zu wollen. Die Gewohnheit der sofortigen Befriedigung aufzugeben und eine Kultur des langfristigen Denkens aufzubauen. Ablehnung von impulsiven Ausgaben, Akzeptanz von Opfern und Einschränkungen.

Die Beziehung zwischen Ihnen und der Welt ist transaktional, wie John Dewey uns lehrte. Nicht nur unsere physischen Körper sind an unsere physische Umgebung gebunden, sondern wir sind auch über die ebenso reale wirtschaftliche Umgebung, an der wir uns beteiligen, miteinander verbunden. Und mit jedem Dollar, den wir ausgeben, und jedem Satoshi, den wir sparen, erschaffen wir unsere Zukunft.

Es gibt eine Weggabelung. Das Schild auf der einen Seite sagt: „Du wirst nichts besitzen und du wirst glücklich sein". Das Schild auf der anderen Seite sagt: „Du wirst Bitcoin besitzen und du wirst die beste Version deiner selbst sein."

Die Wahl liegt bei dir.

Bitcoin hat die Macht, die beste Version von sich selbst hervorzubringen, weil die Anreize von Bitcoin auf gegenseitige Verbesserung ausgerichtet sind. Auf individueller Ebene erfordert der Besitz von Bitcoin eine Änderung der Zeitpräferenz und der Verantwortung. Der Besitz impliziert, dass man seine eigenen Schlüssel besitzt. Wenn du das nicht tun, besitzts du keine Bitcoin, sondern Schuldscheine. Es bedeutet auch, dass du deinen eigenen Knotenpunkt betreiben, um zu überprüfen, ob du tatsächlich Bitcoin besitzen. Wenn man das nicht tut, vertraut man auf das Wort eines anderen, verlässt sich auf seine Sicht von Bitcoin, seine Weltsicht und darauf, dass er einen nicht anlügt.

Darüber hinaus bedeutet der fortgesetzte Besitz von Bitcoin, dass man die Verantwortung übernimmt, einen Wert für die Gesellschaft zu schaffen. Geld tut nichts anderes, als zu zirkulieren, also musst etwas leisten, das andere Menschen als wertvoll empfinden. Wenn du das nicht tust, wirst du bald keine Bitcoin mehr haben. Die Natur wird dich dazu zwingen, dich von deinen Sats zu trennen, denn jeder - auch du - muss essen.

„Beschäftige dich mit dem Sinn des Lebens, wirf leere Hoffnungen beiseite, engagiere dich für deine eigene Rettung - wenn du dich überhaupt um dich selbst kümmerst - und tue es, solange du kannst."\ \ Marcus Aurelius

Der Bitcoin-Weg ist kein einfacher Weg, aber ein erfüllender. Er ist erfüllend, weil du die Regeln kennst, du kennst die Konsequenzen, und du hast die Verantwortung. Es ist ein Weg, der es dir erlaubt, dein Leben so zu gestalten, wie du es für richtig hältst, aber du musstes auch selbst gestalten. Es ist ein Weg, der es dir ermöglicht, sich vor Übergriffen und Diebstahl zu schützen, und der langfristige Sicherheit und Stabilität bietet. Aber du musst ihn gehen. Du musst mitmachen. Du musst ihn ausleben.

Du musst dein Fiat-Selbst ausbrennen und die einfachen Antworten, die Abkürzungen und den Scheinwert hinter dir lassen. Du musst etwas Reales anbieten, jemand Reales sein und im Falle des Scheiterns die realen Konsequenzen tragen.

Die Grenze zwischen Gut und Böse verläuft nicht nur in jedermanns Herzen, sondern auch die Grenze zwischen Fiat und Bitcoin verläuft ebenfalls in jedermanns Herzen. Es geht nicht um „wir gegen sie". Es geht um unser Fiat-Selbst gegen unser Bitcoin-Selbst. Persönliche Verantwortung vs. vorsätzliche Ignoranz. Systemische Fragilität vs. langfristige Stabilität. Mit jeder Handlung triffst du eine Entscheidung, und du hast keine andere Wahl als zu handeln.

Es gibt eine Weggabelung, und jeder Einzelne von uns muss sich entscheiden, welchen Weg er einschlagen will. Den scheinbar bequemen Weg, den die Machthaber vorgeben, oder den Bitcoin-Weg: hart, steinig, mit Höhen und Tiefen, ohne Sicherheitsnetze und ohne Rettungsaktionen. Es ist kein einfacher Weg, aber es ist ein schöner Weg. Ein Weg, der Geduld, Verantwortung und Disziplin lehrt. Ein Weg, der dich demütig macht. Ein sinnvoller Weg. Ein Weg, den zu gehen sich lohnt.

Früher war es ein einsamer Weg, aber das ist er nicht mehr. Früher war es ein verrückter Weg. Heute ist der Weg zu mehr Freiheit der verrückte Weg. Es ist ein langer Weg, ein täglicher Kampf. Und niemand außer dir kann diesen Weg gehen. Ich würde dir gerne sagen, dass ich dich auf dem Gipfel treffe, aber ich fürchte, es gibt keinen Gipfel. Ich treffe dich stattdessen auf dem Weg.

Gigi ist ein professioneller Shitposter und Meme-Kenner. Er ist vor kurzem aus der woken Höllenlandschaft der Vogel-App in das lila gelobte Land des Straußen-Protokolls umgezogen. Wenn er nicht gerade Shitposting betreibt, ist er meistens damit beschäftigt, ein Bitcoin-Genießer zu sein und seine Pflaumen im Glanz der orangefarbenen Münze zu baden. Du kannst ihn herbeirufen, indem du seinem npub in den Kartenschlitz eines stillgelegten Geldautomaten flüsterst:

npub1dergggklka99wwrs92yz8wdjs952h2ux2ha2ed598ngwu9w7a6fsh9xzpc